RussianPatents.com

Chemistry; metallurgy (C)

C
Chemistry; metallurgy
(64415)

C01 - Inorganic chemistry
(4198)
C02 - Treatment of water, waste water, sewage, or sludge
(2722)
C03 - Glass; mineral or slag wool
(2142)
C04 - Cements; concrete; artificial stone; ceramics; refractories
(5756)
C05 - Fertilisers; manufacture thereof
(812)
C06 - Explosives; matches
(889)
C07 - Organic chemistry
(13410)
C08 - Organic macromolecular compounds; their preparation or chemical working-up; compositions based thereon
(6898)
C09 - Dyes; paints; polishes; natural resins; adhesives; compositions not otherwise provided for; applications of materials not otherwise provided for
(5420)
C10 - Petroleum, gas or coke industries; technical gases containing carbon monoxide; fuels; lubricants; peat
(3776)
C11 - Animal or vegetable oils, fats, fatty substances or waxes; fatty acids therefrom; detergents; candles
(934)
C12 - Biochemistry; beer; spirits; wine; vinegar; microbiology; enzymology; mutation or genetic engineering
(10230)
C13 - Sugar industry
(271)
C14 - Skins; hides; pelts; leather
(113)
C21 - etallurgy of iron
(2800)
C22 - etallurgy; ferrous or non-ferrous alloys; treatment of alloys or non-ferrous metals
(6558)
C23 - Coating metallic material; coating material with metallic material; chemical surface treatment; diffusion treatment of metallic material; coating by vacuum evaporation, by sputtering, by ion implantation or by chemical vapour deposition, in general; inhibiting corrosion of metallic material or incrustation in general
(3087)
C25 - Electrolytic or electrophoretic processes; apparatus therefor
(1770)
C30 - Crystal growth
(562)

Melted water generator

Melted water generator

Melted water generator includes successively placed in one longitudinal vessel 1 zones of water freezing, displacement of admixtures from ice front and concentration of admixtures in form of brine, transition of water from solid state into liquid state. In freezing zone installed is circular freezing chamber 2, behind which drive device of longitudinal travel of frozen water rod 3 is mounted. In zone of displacement of admixtures in the centre of frozen rod 3 placed is disconnecting device 6, behind which circular heating element 11 is placed. In lower part of longitudinal vessel 1 placed are separate branch-pipes for output of admixtures in form of brine 8 and melted water 12. Behind circular freezing chamber 2 mounted is drive device, equipped with additional amplifiers of frozen rod 3 travel, made in form of drive screws 15, which pass through zone of water freezing, zone of displacement of sadmixtures, zone of water transition from solid state into liquid state. Position of drive screws 15 relative to longitudinal vessel 1 is provided by slide bearings 16, installed outside longitudinal vessel 1. Drive screws 15 are equipped with heating elements, placed inside axes of screws, with possibility of heating surfaces of blades of drive screws.

Method for deactivation of zirconium-containing concentrate

Method for deactivation of zirconium-containing concentrate includes its processing with acid with heating, processing of product with water with formation of pulp, separation of purified concentrate and its drying. As zircon-containing concentrate zircon concentrate is taken. Said concentrate is milled to size 75-95 wt % of class minus 0.040 mm and subjected to processing with hydrochloric or nitric acid with concentration 5-15% at temperature 70-90°C for 2-3 hours.

Epoxy resin-based curable compositions and composite materials obtained therefrom

Epoxy resin-based curable compositions and composite materials obtained therefrom

Composition consists of a mixture and includes components (A), (B) and (C). Component (A) includes an epoxy-resin based composition which includes a mixture (A1) of epoxy resin and (A2) divinylarene dioxide. Component (B) includes a curing composition and component (C) includes a reinforcing material. Viscosity of the curable composition is in the range of about 0.15 Pa·s to about 1.5 Pa·s. The curable composition is intended to provide a cured composite product made from the curable composition. The curable composition provides a cured composite product having Tg which is about 5°C higher than that of a curable composition containing a reaction diluent. The disclosed composition can be used to produce transparent cast products, composite materials, coatings and adhesives.

Waste water treatment apparatus

Waste water treatment apparatus

Waste water treatment apparatus is divided into two units: an upper unit and a lower unit. The upper unit includes a primary treatment unit, which includes a sand box 2, an oil trap-settling tank 3 and a floatation unit-settling tank 4. The lower unit includes a filtering unit which is separated from the primary treatment unit and consists of two filters: a filter with a granular bed 5 and a sorption filter 6.

Method of inhibiting microorganisms in pulp and paper industry

Invention can be used in the pulp and paper industry for inhibition and control of microbial growth in the technical and circulating waters. For implementing the method, in the water to be treated a preliminary prepared mixture of bromochlorodimethylhydantoin and sodium hypochlorite is added, with the concentration of bromochlorodimethylhydantoin of 0.1 to 7.5 g/l, and their ratio in terms of active chlorine from 1:15 to 15:1.

Charcoal kiln

Charcoal kiln

Invention can be used in coal and wood-chemical industries. This kiln comprises heat-insulated pyrolysis chamber (1) connected via heat-insulated pipe (30) with condensation system including cooler (3) and hotwell (31). Cooler (3) is composed of shell-and-tube heat exchanger with its tube space communicated with air heaters (42) via heat-insulated drying chamber (4). Charcoal kiln comprises furnaces (2) composed of communicated gas generator (15) and combustion chamber (16) provided with the afterburner (23) of uncondensed pyrolysis gases and gas duct (8) with shutter (11). Combustion chamber (16) incorporates extra afterburner (52) of sump condensate. Gas duct (8) is equipped with pressure control valve (64), pipe (35) located upstream of shutter (11) from the side of combustion chamber (16) and, via hydraulic lock (58), with recuperative heat exchanger (51). Hotwell (31) is composed of sump communicated via pipe (59) arranged at its sidewall with vessel (56) for collection of water-soluble portion of condensate and, via pipe (60) at sidewall lower part, heater (62) and pump (53), with afterburner of sump condensate (52).

Method for obtaining aviation gasoline b-100/130

Invention describes method for obtaining aviation gasoline B-100/130, based on gasoline, containing components of catalytic reforming, isomerisation, alkylation with addition of antioxidative additive, tetraethyl lead and dye, characterised by the fact that as base, used is fraction, boiling out in the interval 40-145°C, separated from target automobile gasoline AI-95 by rectification in accordance with periodic or continuous scheme.

Thermal-oxidative cracking method of heavy oil residues

Thermal-oxidative cracking method of heavy oil residues

Invention relates to processing of heavy oil residues at high temperature and pressure that includes contact of preheated initial raw material with oxygen-containing gas in cracking reactor, discharge of gaseous products from the top section of cracking reactor and cracking heavy residual from the bottom section of cracking reactor and further extraction of light hydrocarbon fractions by rectification. The method is characterized by condensation and return to the reactor of a part of gaseous products discharged from the reactor top section.

Conjugates for prevention or treatment of nicotine addiction

Conjugates for prevention or treatment of nicotine addiction

Invention relates to conjugates, in particular presented is nicotine hapten-carrier of formula (III): W represents -O- and is in position 5 of pyridine ring; -(spacer)- represents C1-C8alkylene group, C3-C10cycloalkylene group or C1-C12alkylene group, interrupted by 1-4 oxygen atoms and possibly interrupted by group -N(H)C(O)-; X* represents -NH- or -S-; m stands for 1; n stands for integer number from 1 to 1000; and Y represents possibly modified carrier protein, selected from bacterial anatoxins, immunogenic substances, viruses, virus-like particles, protein complexes, proteins, polypeptides, liposomes and immunostimulating complexes, which can be used for preparation of vaccines for treatment and/or prevention of nicotine dependence.

Encapsulates

Encapsulates

Group of the inventions relates to field of delivery of useful agents in consumer goods, namely deals with encapsulate, containing envelope, based on cross-linked polymer, and core, containing material, selected from the group, consisting of fragrance, silicon, biocontrol agent, antimicrobial agent, flavour, warming or cooling agent, medication, sunscreen preparation and their mixtures. Said envelope additionally contains fragment, sensitive to electromagnetic radiation, selected from the group, consisting of visible light, ultraviolet radiation and their mixtures, provided by monomer of structure:

Bacteriophage-containing room deodorant

Bacteriophage-containing room deodorant

Room deodorant contains a concentrate of selected high-avidity bacteriophages of the species Klebsiella pneumoniae, Staphylococcus aureus, Streptococcus pyogenes, Salmonella enterica, Proteus mirabilis, Proteus vulgaris, Klebsiella pneumoniae, Yersinia pseudotuberculosis, Yersinia enterocolitica, Pseudomonas aeruginosa. The concentrate of the above bacteriophages possesses Appelman's lytic activity 10-8 of each bacteriophage. The bacteriophages are grown on a dense medium and purified by ultrafiltration. The above agent contains a perfume compound and isothiozolinone-based preserving agents not reducing bacteriophage activity. Bacteria nutrients are absent.

Photosensitising compositions

Invention relates to photochemotherapy and photodynamic therapy, namely to application of pharmaceutically acceptable salt of amphiphilic photosensitising preparation in method of photochemical internalisation, where said salt possesses water solubility of at least 30 mg/ml and is selected from diethanolamine salt TPCS2a, diethanolamine salt TPPS2a, ethanolamine salt TPPS2a and triethanolamine salt TPPS2a.

Peroxide solution and set for disinfection of contact lenses

Peroxide solution and set for disinfection of contact lenses

Group of inventions relates to medicine, namely to disinfecting systems for medical devices. For this purpose hydrogen peroxide solution is used for disinfection of contact lenses. To increase effective time of activity of hydrogen peroxide solution to 6 hours and its residual concentration lower than 100 ppm catalyst is used. Components for disinfection of contact lenses are placed into device, which includes a) container for water solution of hydrogen peroxide, containing effective quantity of vinylpyrrolidone copolymers and b) container, which contains disk, representing substrate with catalytic covering, with disk having to be completely submerged into hydrogen peroxide solution. Catalyst application provides increased concentration of oxygen peroxide by at least 80%.

Adhesive acidic cleaning and flavouring substance for plumbing fixtures

Adhesive acidic cleaning and flavouring substance for plumbing fixtures

Invention relates to field of sanitary and is intended for cleaning plumbing fixtures. Substance for cleaning plumbing fixtures is capable of direct application on a plumbing fixture, adhering to it, as well as is capable of free washing off only after a large number of washing off operations. Said substance includes surface-active substances (SAS) and at least one adhesion intensifier, representing oxoacid of the following formula:

Method of treating hair cover of sheepskin

Method of treating hair cover of sheepskin includes treating a semi-product with a plasticising composition, cutting hair and treatment twice with a fixing agent containing formalin with intermediate smoothing, wherein as the plasticising composition a collagen-containing dispersion in an organic acid with total consumption thereof of 0.26-0.15 g/m2 is used; treatment of the sheepskin with the plasticising composition is carried out twice with intermediate ageing at room temperature, and as the fixing agent formalin (40%) with concentration of 70 ml/l with total consumption of 0.2-2.0 ml/m2, at smoothing temperature of 135-140°C is used. The disclosed treatment provides high quality of hair cover with an optimum moderate mode of processing factors.

Liqueur

Liqueur for production of 1000 dhal whereof one uses the following ingredients, l: chokeberry mors - 200-700, water-and-alcohol felon herb first drainage infusion - 10-15, water-and-alcohol barberry first drainage infusion - 50-70, water-and-alcohol loshtak (bryony) root first drainage infusion - 3-5, as well as the following ones in kg: natural honey - 2-5, vanillin - 0.01-0.03, colorant - 15-20, water-and-alcohol liquid - in an amount required for 18-50 vol % proof.

Strain of microalga haematococcus pluvialis - producent of natural astaxanthin

Strain of microalga haematococcus pluvialis - producent of natural astaxanthin

Strain of microalga Haematococcus pluvialis VM1 is deposited in the Russian Collection of Microalgae at the institution Institute of Timiryazev Plant Physiology of the Russian Academy of Sciences (IPPAS) under the registration number IPPAS H-2018 and may be used to produce astaxanthin.

Using prdx2 and/or prdx6 for producing pharmaceutical composition for treating or preventing injury, aging or disease caused by level increase of reactive oxygen intermediates

Using prdx2 and/or prdx6 for producing pharmaceutical composition for treating or preventing injury, aging or disease caused by level increase of reactive oxygen intermediates

Invention refers to biotechnology and represents using hydrogen peroxide oxidoreductase for producing a pharmaceutical composition for improving spermatic fluid quality or treating male infertility, wherein hydrogen peroxide oxidoreductase represents PRDX2 protein. The invention also refers to a composition applicable for improving spermatic fluid quality or treating male infertility, containing PRDX2 protein and a pharmaceutically acceptable carrier.

Method for activation of microflora at laboratory stage of kvass starters incubation cycle

Invention represents a method for microflora activation at the laboratory stage of kvass starters incubation cycle including a saccharified brew preparation, lactic acid bacteria propagation and usage Saccharomyces cerevisiae pressed bakery yeast where the grain mixture consists of first grade wheat flour and bran at a ratio of 1:1, physiologically active growth factors represented by yeast autolysate (50.0 ml/l) and grape seed powder (5 g/l); then one performs sterilisation by way of three-time autoclaving at 1.0 atm during 45-60 min; the starter cultures are represented by a complex of lactic acid bacteria of Lactobacterin and/or Evitalia; at the final stage of the incubation cycle one introduces Saccharomyces cerevisiae pressed yeast in a dosage of 5 g/100 dm3 of kvass wort.

Cell line of human kidney cancer ibgvat r 6

Cell line can be used, for example to create antitumor vaccines (whole-cell or genetic engineering), testing of activity of various pharmaceuticals, creation of diagnostic kits and test systems for development of new medicines. The cell line is deposited in the Russian national collection of industrial microorganisms (RNCIM) under the registration number N-151.

Cell line of human kidney cancer ibgvat r 27

Cell line can be used, for example to create antitumor vaccines (whole-cell or genetic engineering), testing of activity of various pharmaceuticals, creation of diagnostic kits and test systems for development of new medicines. The cell line is deposited in the Russian national collection of industrial microorganisms (RNCIM) under the registration number H-152.

Set of synthetic oligonucleotides for species identification of bupleurum multinerve (bupleurum multinerve dc)

Set of synthetic oligonucleotides for species identification of bupleurum multinerve (bupleurum multinerve dc)

Invention relates to a set of synthetic oligonucleotides for species identification of Bupleurum multinerve (Bupleurum multinerve DC.), comprising polymerase chain reaction with a fragment ITS2 of nuclear DNA. And for identification species-specific portions are used to create the forward, reverse primers and destroyed probe, where the forward primer is the DNA sequence with the following nucleotide structure: 5'-TATCCCGGCTCTCGCATCGA-3'; the reverse primer is the DNA sequence with the following nucleotide structure: 5'-GACGAGGCACGGGAGGTCAG-3', the destroyed probe DNA sequence with the following nucleotide composition (fluorescent label)-5'-CCGTGAACCATCGAGTTTTT-3'-(quencher).

Strain of bacteria escherichia coli - producer of fumaric acid and method of obtaining fumaric acid using this strain

Strain of bacteria escherichia coli - producer of fumaric acid and method of obtaining fumaric acid using this strain

Group of inventions relates to the strain of bacteria Escherichia coli FUM1.0 which is a producer of fumaric acid and to a method of obtaining fumaric acid using this strain. The strain is obtained by the inactivation of the genes ackA, pta, poxB, ldhA, adhE, pflB, frdA, frdB, sdhA, sdhB, aceA, aceB, and ptsG and amplification of the expression of the genes galP and glk in the strain Escherichia coli K-12 MG1655. The method of obtaining fumaric acid provides the cultivation of the named strain in suitable conditions with the subsequent release of fumaric acid from cultural liquid. The factor of conversion of glucose in fumaric acid at the cultivation of the offered strain amounts 1.31 mol/mol that is 65.5% of the theoretically possible maximum.

Method of separation and purification of 1,4-diaminobutane from fermentation solution

Method of separation and purification of 1,4-diaminobutane from fermentation solution

Claimed invention relates to biotechnology. Claimed are methods of separation and purification of 1,4-diaminobutane from fermentation solution. Claimed method of separation and purification of 1,4-diaminobutane from fermentation solution, containing 1,4-diaminobutane, obtained by fermentation, includes stages of cell mass separation, addition of alkaline substance and removal of formed salts, concentration, removal of admixtures and extraction of obtained 1,4-diaminobutane. Also claimed is method for separation and purification of 1,4-diaminobutane from fermentation solution, containing 1,4-diaminobutane, obtained by fermentation, which includes separation of cell mass, addition of alkaline substance and removal of formed salts, low-temperature concentration, crystallisation, filtration, high-temperature concentration and distillation. Claimed methods of separation and purification make it possible to obtain 1,4-diaminobutane by biotechnology methods from fermentation solution with high output and purity.

Method for obtaining bacteriophage strain, specific strains of bacteriophages and their application

Method for obtaining bacteriophage strain, specific strains of bacteriophages and their application

Group of inventions relates to method for identification of bacteriophage strain, versions of bacteriophage strain and their application. Method includes obtaining collection of strains of bacteriophages, cultivation of Salmonella spp strain on sterile culture medium, application of culture samples on plate, addition of suspension of tested bacteriophage strain in concentration 6.5 x 109 pfu, with ratio of bacterial suspension to suspension with phage 1:1, 1:1.5 or 1:3 and incubation at 37°C for 4 h. Resazurin is added to culture samples with further incubation in darkness at 37°C for 3 h. Colour and fluorescence of culture are controlled. Bacteriophage strain, contained in culture, preserving blue colour or not demonstrating significant increase of fluorescence in comparison with control, is identified as bacteriophage strain, specific to selected pathogen. Also claimed are bacteriophage strain PCM F/00069, bacteriophage strain PCM F/00070 and bacteriophage strain PCM F/00071 and their application for preparation obtaining.

Peptide for medical treatment of pancreatic diabetes of 2nd type and its complications

Peptide for medical treatment of pancreatic diabetes of 2nd type and its complications

Analogue of exenatide with formula H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Gly-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-OH is suggested.

Recombinant dna providing in composition of plasmid vector synthesis in cells of ecoli of chimeric protein - a-i apolipoprotein of human being

Recombinant dna providing in composition of plasmid vector synthesis in cells of ecoli of chimeric protein - a-i apolipoprotein of human being

Recombinant DNA is offered, which provides in the composition of a plasmid vector the synthesis in cells of E.coli of a chimeric protein - apolipoprotein A-I of a human being, with the size of 852 bps. The recombinant DNA in series includes from 5'- end DNA fragment coding 6 a.o. of histidine with the size of 18 bps (SEQ ID NO 1), DNA fragment coding 6 a.o. pro-form of the protein apoA-I of a human being with the size of 18 bps (SEQ ID NO 2), DNA fragment coding N-end fragment from 15 a.o. of bull pancreatic RNAase A (SEQ ID NO 3) with the size of 45 bps, DNA fragment coding 6 a.o. pro-form- of the protein apoA-I of a human being with the size of 18 bps (SEQ ID NO 2), DNA fragment coding the site of the recognition of protease of a tobacco mosaic virus with the size of 21 bps (SEQ ID NO 4), mutant gene of a mature protein apoA-I of a human being with the size of 729 bps (SEQ ID NO 5). The yield of the chimeric protein of apolipoprotein A-I of a human being from 1 l of the culture of the cells E.coli is 182±32 mg that amounts 39.7±6.2 mg from 1 g of the biomass.

Methods for enzymatic interesterification/esterification, in which lipases, immobilised on hydrophobic resins, are used in presence of water solutions

Methods for enzymatic interesterification/esterification, in which lipases, immobilised on hydrophobic resins, are used in presence of water solutions

In method used are enzymes, immobilised on hydrophobic resin, mixed with source of fatty acids and alcohol or alcohol donor, in presence of alkali or weak alkali water buffer or in presence of water or water solution. Method for obtaining esters of fatty acids is realised by interesterification or esterification simultaneously or successively. Claimed system includes equipment and reagents for realisation of method with high efficiency.

Novel o-acetylhomoserine-sulphhydrilase or its mutant protein and method for conversion onto methionine with thereof application

Novel o-acetylhomoserine-sulphhydrilase or its mutant protein and method for conversion onto methionine with thereof application

Claimed invention relates to novel protein, possessing O-acetylhomoserine-sulphhydrilase activity, its mutant protein, polynucleotide, coding thereof, recombinant vector, switching on polynucleotide, microorganism, transformed with recombinant vector, and method for obtaining methionine or acetic acid with protein application.

Method for producing organic compounds by biomass fermentation and zeolite catalysis

Method for producing organic compounds by biomass fermentation and zeolite catalysis

What is presented is a method for producing organic compounds. The method involves biomass fermentation in a fermenting box with volatile organic compounds generated, removal of the volatile organic compounds by gas stripping by means of a carrier gas, adsorption of the volatile organic compounds from a gas flow, desorption of the volatile organic compounds from the adsorbent, a catalytic reaction of the volatile organic compounds. A catalyst is zeolite, whereas the volatile organic compounds are alcohols, and/or ketones, and/or aldehydes, and/or organic acids.

Biomarker

Biomarker

Invention relates to field of biotechnology, in particular to cancer biomarkers, and can be used in medicine. Detection of Engrailed-2 (EN2) protein or thereof coding nucleic acid in sample of patient's urinary bladder or urine can be used in diagnostics of urinary bladder cancer or for identification of patient who has risk of urinary bladder cancer, as well as for monitoring of urinary bladder cancer progressing in patient or monitoring efficiency of urinary bladder cancer treatment.

Non-toxic recombinant shiga toxin type 2 (stx2)

Non-toxic recombinant shiga toxin type 2 (stx2)

Invention refers to molecular and medical biology, and particularly to genetically modified proteins. What is presented is Stx2[E167Q/R170H] protein, which carries point substitutions of two amino acid residues in a catalytic site region of Stx2A sub-unit, responsible for protonation of adenine of A4324 residue of 28S RNA of eucariotic ribosomes, namely a point substitution of [E167Q] glutamic acid residue in position 167 by a glutamine residue and a point substitution of [R170H] arginine residue in position 170 by a histidine residue. The produced protein has more than 106 times lower cytotoxicity and high immunogenicity.

Microorganisms for obtaining putrescine and method for obtaining putrescine with application thereof

Microorganisms for obtaining putrescine and method for obtaining putrescine with application thereof

Invention relates to biotechnology, namely to putrescine-producing microorganism and method for obtaining putrescine with thereof application. Putrescine-producing microorganism is modified in such a way that activity of ornithinecarbamoyltransferase and protein, participating in glutamate (NCgl1221) export in comparison with their endogenic activities is deleted in it, and ornithinedecarboxilase (ODC) activity is introduced into microorganism.

Device for cultivation of cell cultures

Device for cultivation of cell cultures

Device for cultivation of cell cultures is offered. The device comprises the external tubular housing with the upper end and the lower end. The upper end has a hole, and the lower end is closed by the membrane with internal surface and external surface for sowing of biological material. The device contains the supplementing tubular housing with the internal diameter corresponding to the outer diameter of the lower end of the external tubular housing, and also the suspended element with the upper end and the lower end. From the upper end of the suspended element the flange is oriented aside, and the outer diameter of the suspended element corresponds to the internal diameter of the external tubular housing. The external tubular housing at the first stage of cultivation is connected to the supplementing tubular housing with formation of the standing insert. At the second stage the external tubular housing is disjoined from the supplementing tubular housing and in the reversed position is attached to the suspended element.

Method of binding mycobacteria

Method of binding mycobacteria

Method of binding Mycobacteria and/or fragments of Mycobacteria is provided, which present in an aqueous liquid with the solid surface. The said liquid is added to a sufficient amount of a water soluble polymer in the presence of a solid surface to displace Mycobacteria and/or their fragments from the said liquid onto the solid surface. The surface may be provided in the form of a microsphere. The water-soluble polymer can be selected as, for example, dextran, polyethylene glycol, polyvinylpyrrolidone.

Method for fermentation of hydrogen-containing gaseous substrate

Method for fermentation of hydrogen-containing gaseous substrate

Invention relates to field of biochemistry. Claimed is method for obtaining one or several alcohols from gaseous substrate. Method includes fermentation of gaseous substrate, containing one or more of hydrogen (H2) and carbon monoxide (CO), in water medium in bioreactor, increase of cell density by regulation of hydrogen absorption. Regulation of hydrogen absorption includes determination of hydrogen supply rate, hydrogen discharge rate and regulation of rate of supply of one or more of gaseous substrate and hydrogen. Regulation of hydrogen absorption includes supply of said gaseous substrate in such a way that molar ratio of said hydrogen absorption and rate of gaseous substrate supply is in the first specified interval from 0.001 to 1.0 and in second specified interval from 0.001 to 1.0.

Method for fermentation of carbon monoxide-containing gas

Method for fermentation of carbon monoxide-containing gas

Invention relates to field of biochemistry. Claimed is method of gaseous substrate fermentation. Method includes supply of carbon monoxide-containing gaseous substrate into culture water medium in bioreactor, where said culture medium includes one or several anaerobic acetogenic microorganisms, increase of cell density by regulation of specific CO absorption by anaerobic acetogenic microorganisms in culture water medium, with rate of rate of change of specific CO absorption switching on regulation of CO supply rate, with regulation of CO supply rate switching on determination of CO supply rate, determination of CO discharge rate and determination of weight of cells. Change of specific CO absorption in the interval from 0.1 to 1.0 mmol/min/gram of dry cells. Supply of continuous water medium flow into bioreactor, discharge of continuous flow of fermentation broth from bioreactor, with said stages being repeated until required productivity by ethanol in the interval from 1 to 50 g/l is achieved.

Method of sensitivity testing of mycobacterium tuberculosis to pharmaceuticals, use of indicator and solid medium

Method of sensitivity testing of mycobacterium tuberculosis to pharmaceuticals, use of indicator and solid medium

Method of sensitivity testing of Mycobacterium tuberculosis to the pharmaceuticals, indicator use for the said method is suggested, where the indicator is tellurite or mixture of tellurite and urea, solid medium for the sensitivity test method, use of the solid medium, heating thermostat for the sensitivity test method and cultivation box for the sensitivity test method are also suggested. The method includes production of the rich samples with Mycobacterium tuberculosis, addition of the liquid culture medium to samples, heating and melting of the solid medium, mixing of liquid medium samples with melted solid medium, solidification of the liquid samples to obtain the solid samples for testing of the sensitivity to the pharmaceuticals using the paper strips, cultivation of the solid samples, indicator addition to the solid sample, and monitoring of the inhibition zone of the pharmaceutical as per level of indicator indication. The solid sample includes 50-100 ml of vitelline liquid, 2-8 g of soluble starch, 0.1-0.8 g of L-casein, 2-8 ml of phenol red, 0.5-3.5 g of agar or agarose and bacteriostat.

Methods for oil refining

Methods for oil refining

Claimed invention relates to biochemistry and discloses method for oil refining. For method realisation water solution of acid is mixed with oil to obtain mixture, with pH 1-4, after which bases are added to said mixture with obtaining mixture with pH 6-8. As a result emulsion, which contains more than 60 vol % of water phase with drop size about 15-45 mcm. Recombinant phosphatidylinositol-specific phospholipase C (PI-PLC), which has amino acid sequence SEQ ID NO:8, is added into said emulsion. After realisation of described method stages inositoltriphosphate can be separated.

Protein complexes containing superhelix and/or banding, and their use

Protein complexes containing superhelix and/or banding, and their use

Antibody is suggested for use as bispecific antibody, characterized in that contains 4 polypeptides. The first and the second polypeptides contain: VH-domain linked with constant domain, and super helical domain. At the super helical domain is linked with the constant domain by decomposable linker, and contains in case of the first polypeptide the heptade repeat: (X1X2X3X4X5X6X7)n, and in case of the second polypeptide the super helical domain contains hepdate repeat: (X'1X'2X'3X'4X'5X'6X'7)n, where n is larger or equal to 2. X1, X'1 is hydrophobic amino-acid residue or asparagine, each of X2, X3, X6, X'2, X'3 and X'6 is any amino-acid residue, X4, X'4 is hydrophobic amino-acid residue, and each of X5, X7, X'5 and X'7 is charged amino-acid residue. At that in each heptade repeat the first super helical domain contains X5 residue that is opposite in terms of charge sign to X'7 residue of the second super helical domain, and the first super helical domain contains X7 residue that is opposite in terms of the charge sign to X'5 residue of the second super helical domain. The third and forth polypeptides contain the first and second VL-domains, respectively. Besides the antibody is suggested for use as heterodimeric one containing three polypeptides. At that the first polypeptide contains: VH-domain linked with constant domain, and super helical domain. The second polypeptide contains the constant domain containing CH2- and CH3-domains, and super helical domain. At that the super helical domain is linked with the constant domain by decomposed linker, and contains the heptade repeat same as in bispecific antibody. The third polypeptide contains VL-domain. Also the method of antibody production is described, it provides for stage of cell cultivation containing vector, coding the antibody under the invention in culture medium.

Bispecific antigen-binding proteins

Bispecific antigen-binding proteins

Invention refers to biotechnology and represents a method for producing a bispecific antigen-binding protein containing: two light chains and two heavy chains of a full-length antibody containing two Fab fragments and specifically binding to the first antigen; and two supplementary Fab fragments of the antibody, which specifically binds to the second antigen, wherein the above both supplementary Fab fragments are fused by means of a connector peptide to C- or N-terminals of the heavy chains specified in sub-clause a); wherein the connector peptide represents (Gly-x-Ser)n, or (Gly-x-Ser)nGlym(x = 3, n = 3, 4, 5 or 6 and m = 0, 1, 2 or 3), or (x = 4, n = 2, 3, or 5 and m = 0, 1, 2 or 3) and wherein the Fab fragments are modified as follows: I) in both of the Fab fragments specified in sub-clause a), or in both of the Fab fragments specified in sub-clause b), variable domains VL and VH are substituted by each other, and/or constant domains CL and CH1 are substituted by each other; II) in both of the Fab fragments specified in sub-clause a), variable domains VL and VH are substituted by each other, and constant domains CL and CH1 are substituted by each other, and in both of the Fab fragments specified in sub-clause b), variable domains VL and VH are substituted by each other, or constant domains CL and CH1 are substituted by each other; III) in both of the Fab fragments specified in sub-clause a), variable domains VL and VH are substituted by each other, or constant domains CL and CH1 are substituted by each other, and in both of the Fab fragments specified in sub-clause b), variable domains VL and VH are substituted by each other, and constant domains CL and CH1 are substituted by each other; IV) in both of the Fab fragments specified in sub-clause a), variable domains VL and VH are substituted by each other and in both of the Fab fragments specified in sub-clause b), constant domains CL and CH1 are substituted by each other; or V) in both of the Fab fragments specified in sub-clause a), constant domains CL and CH1 are substituted by each other and in both of the Fab fragments specified in sub-clause b), variable domains VL and VH are substituted by each other; whereas the method involves the stages of: a) transforming a host cell by means of expression vectors, which contain nucleic acid molecules coding the above bispecific antigen-binding protein; b) culturing the host cell in the environment, which enable synthesising a molecule of this bispecific antigen-binding protein; and c) recovering the molecule of the above bispecific antigen-binding protein from the above culture.

Constructed cells, expressing multiple immunomodulators, and thereof application

Constructed cells, expressing multiple immunomodulators, and thereof application

Claimed invention relates to field of biotechnology and can be used for recombinant expression of immunomodulatory proteins. Vector, containing polynucleotide which codes gene switch, is constructed, with said polynucleotide containing (1) at least one transcription factor sequence which is functionally bound with promoter, with said at least one transcription factor sequence coding ligand-dependent transcription factor, and (2) polynucleotide, which codes peptide IL-12 an one or more immunomodulatory polypeptides, selected from IL-2, IL-7, IL-15, IL-18, IL-21, GM-CSF, CCL3 (MIP-1a), CCL5 (RANTES), CCL7 (MCP3), XCL1 (lymphotactin), CCL19 (MIP-3b), CXCL9 (MIG), CXCL10 (IP-10), CXCL12 (SDF-1), CCL21 (6Ckine) or TNF-alpha.

Versions of c-type natriuretic peptide

Versions of c-type natriuretic peptide

Invention refers to gene engineering, more specifically to producing C-type natriuretic peptide (CNP), and may be used in medicine. What is produced is a peptide having the structure PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37) applicable for treating degenerative bone pathologies in response to CNP.

Removal of aggregates with high molecular weight by hydroxyapatite chromatography

Removal of aggregates with high molecular weight by hydroxyapatite chromatography

Invention relates to field of biotechnology. Method for separation of monomer antibody from composition, containing aggregates of antibodies with high molecular weight, includes contact of composition with hydroxyapatite resin and elution of purified antibody from resin.

Method for obtaining soluble recombinant interferon protein without denaturation

Method for obtaining soluble recombinant interferon protein without denaturation

Claimed invention relates to field of production of recombinant proteins in bacterial hosts. Invention additionally relates to extraction of soluble, active recombinant protein from insoluble fraction without application of denaturation and without necessity of refolding stage.

Granule for use in powder detergents and composition of granule detergent

Granule for use in powder detergents and composition of granule detergent

Granule for use in powder detergents, and composition of granule detergent are suggested. The granule contains core and protective coating in amount of 10-50 wt % relatively to the core. The core contains amylase, protease, cellulase or lipase, thiosulphate of alkali or alkali-earth metal or methionine - 0.5-5 wt % in relation to the core, magnesium sulphate or zinc sulphate - 0.1-15 wt % of waterless salt in relation to the core, and mixture of citric acid and citrate - 1-5 wt % in relation to the core. The protective coating contains at least 75 wt % of sodium sulphate, and one or more other materials selected from the fillers, substances preventing their adhesion, pigments, dyes, plastifiers, binding substances. Composition of granule detergent contains the surface-active substance and said granule.

Stem cell produced from human monocyte and used for therapeutic application and method for inducing it

Stem cell produced from human monocyte and used for therapeutic application and method for inducing it

Invention refers to biotechnology. There are presented stem cells produced by culturing human monocytes in the presence of (i) M-CSF in the concentration of 5 to 100 ng/ml and (ii) at least one representative specified in a group consisting of ganglioside in the concentration of 1 to 100 mcg/ml and a water-soluble herbal extract produced by Folch extraction, in the concentration from 0.1 to 100 mcg/ml, thereby differentiating monocytes, wherein the expression of CSCR4 gene of the above stem cells is more than three or four times as much as the expression by the stem cells produced by culturing human monocytes in the presence of M-CSF and IL-3, and the expression of CSCR4 gene of the above stem cells is more than two or three times as much as the expression by mesenchymal stem cells taken from bone marrow, for treating the diseases associated with cell damages, tissue or organ damages.

Method of processing rare-earth concentrate

Method of processing rare-earth concentrate

Invention can be applied for processing and deactivation of rare-earth concentrate (REC), extracted from apatite concentrate and products of its processing - phosphogypsum and extraction phosphoric acid. Rare-earth concentrate, extracted from raw material, which contains products of uranium-thorium series decay, are dissolved in nitric acid with heating and agitation of pulp, which is then diluted with water and cooled. After this, hydrogen peroxide with consumption which ensures 98.0-99.5% reduction of cerium (+4) to cerium (+3) is added. Then nitric acid solution of rare-earth elements (REE) is separated by means of filtration, from which thorium is separated in co-precipitation with barium sulphate by addition of sulphates and soluble barium compounds. Then neutralisation to pH 2.5-3.9 is carried out by mixing at temperature 35-45°C for 1.0-1.5 hours. Barium-thorium cake is separated by filtration.

Enzymatic method of obtaining aldehydes

Enzymatic method of obtaining aldehydes

Invention relates to biotechnology. Claimed is method for obtaining aldehydes. Glycerol or 1,2-propanediol and hydro-lyase, selected from glycerol-dehydratases, diol-dehydratases and propanediol-dehydratases are brought in contact. Cells of microorganisms, possessing hydro-lyase activity can be also used. Compound, which forms bond with aldehyde and is selected from the group, including sulphites, metabisulphites and pyrosulphates, is added. Suspension is incubated. After that, formed aldehyde and hydro-lyase are separated. Previous stages are repeated with participation of hydro-lyase. In case of necessity separation of formed aldehyde is realised.

Method for manufacturing flexible electroconductive polymer film

Method for manufacturing flexible electroconductive polymer film

Method for manufacturing flexible electroconductive polymer film consists in pre-treatment of flexible polymer substrate based on polydymethyl siloxane or polyethylene naphthalate by low-temperature plasma, and further chemical modification in vapours of (3-mercaptopropyl)-trimethoxysilane or (3-aminopropyl)-trimethoxysilane with subsequent application of silver nano-ink on top of it and sintering of the formed structure.

Another patent 2550857.

© 2013-2015 Russian business network RussianPatents.com - Special Russian commercial information project for world wide. Foreign filing in English.