Strain fusarium sambucinum - producent of fungal protein biomass

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology. Claimed is strain of Fusarium sambucinum, deposited in VKPM collection under number F-1161. Claimed strain is producent of protein food biomass.

EFFECT: invention makes it possible to accumulate biomass with high protein content with higher quantity of valuable unsaturated fatty acids, complete in composition.

2 tbl, 3 ex

 

The technical field

The invention relates to biotechnology and pharmacology and the receipt of a new strain-producer of edible mushroom protein biomass. The most effective present invention can be used in the production of fungal protein biomass by means of liquid-phase submerged culture in food and medical industries.

The level of technology

Among the producers of mushroom protein biomass obtained by liquid-phase submerged culture, known strains of the genera Agaricus [Kyoungju Kirn et al. (2011). Bioproduction of mushroom mycelium of Agaricus bisporus by commercial submerged fermentation of the production of meat analogue.// J Sci Food Agric, Vol.91, pp.1561-1568], Pleurotus [Jin-Zhong Wu. Studies on submerged fermentation ofPleurotus tuber-regium (Fr.) Singer - Part 1: physical and chemical factors affecting the rate of mycelial growth and bioconversion efficiency./ Jin-Zhong Wu, Peter C.K. Cheung, Ka-Hing Wong, Nian-Lai Huang// Food chemistry. - 2003. - V.81. - pp.389-393], Panus [EN 2186851, C12P 21/00, C12N 1/14, C12N 1/14, C12R 1:645, publ. 10.08.2002], Pholiota [El-Makhzangy A. Propagation of three mushrooms genera in submerged culture of mango stone infusion./ A. El-Makhzangy// Alexandria journal of food science & technology. - 2004. - V.1. - No.2. - pp.23-29], Fusarium [US 4501765, A23J 3/00, publ. 26.02.1985; US 4466988, A23J 1/18, publ. 21.08.1984; Weibe, 2004. Myco-protein from Fusarium venenatum: a well-established product for human consumption.// Appi Environ Biotechnol, vol. 58, pp.421-427], Neurospora [US 4938972, A23L 1/00; publ. 03.07.1990; Murray Moo-Young, Yusuf Chisti, Dagmar Vlach (1993). Fermentation of cellulosic materials to mycoprotein foods.// Biotech Adv., Vol.11, pp.469-479], strains of order (:family Chonaephoraceae (can trispora, Gilbertella persicaria), Cunninghamellaceae (Absiia pseudocylindrospora), Mortierelaceae (Mortierella alpina) and tuberculariaceae, genus Fusarium (Rhizopus stolonifer, Rhizopus miehei, Rhizopus pusillus, Rhizopus oligosporus, Rhizopus oryzae; Mucor heimalis, Mucor rouxii; Rhizomucor meihei), and Phycomyces blakesleeanus [US 7045160 B1, A23J 1/18, A23J 3/20, publ. 16.05.2006] and others

Known strains-producers of protein biomass of Pleurotus ostreatus VKPM F-697 [EN 2092548, C12N 1/14, C12P 21/00, C12N 1/14, C12R 1:645, publ. 10.10.1997] and Pleurotus ostreatus VKPM F-720 [EN 2126831, C12N 1/14, SR 21/00, C12N 1/14, C12R 1:645, publ. 27.02.1999], cultivated in deep conditions on different liquid media (medium with peptone, molasses, soy-starch, corn starch, potato-glucose mineral medium with glucose). Mass fraction of crude protein in the biomass of the proposed strains ranging from 40 to 50% of the AFM. The disadvantage of these strains is relatively low biomass productivity from of 0.21 to 0.37 g·l·h-1and the scarcity of biomass on such essential amino acids like cystine and valine. The availability of a wide range of non-traditional flavors of biomass can also be a disadvantage, because there is a necessity of varying the composition of the nutrient medium, depending on the further application of biomass.

Known strains-producers of protein biomass of Pleurotus ostreatus 2-204 VKPM F-811 [EN 2189395, SR 21/00, C12N 1/14, C12N 1/14, C12R1:645, publ. 20.09.2002] and Panus tigrinus 3-204 VKPM F-810 [EN 2186851, SR 21/00, C12N 1/14, C12N 1/14, C12R 1:645, publ. 10.08.2002], cultivated in deep conditions at different liquid nutrients from the meals. The disadvantages of these strains are sufficiently low content of crude protein in biomass (from 28 to 40% AFM), and relatively poor fatty acid composition (relative content of unsaturated fatty acids in the biomass is: oleic (C18:1) is 19.5 and 23.2%; linoleic (C18:2) - 7,1 and 13.6%, respectively; linolenic (C18:3) to 1.3%).

Known use as producers of protein biomass of the strains of the genus Penicillium: Penicillium nonatum and Penicillium chrysogenum [US 3912825, A23J 1/00, publ. 14.10.1975]. Deep cultivation of the strains carried out on a variety of raw materials of vegetable origin, such as feed wheat, hydrolyzed potato, molasses, bagasse and/or citrus waste. The disadvantage of the proposed strains is relatively low content in biomass crude protein from 42% to 46% AFM (total nitrogen by Kjeldahl from for 6.81 to 7.38%, the multiplier - 6,25).

Known use as producers of protein biomass of the strains of the genus Fusarium: Fusarium solani, Fusarium oxysporum and Fusarium frost [US 4466988, A23J 1/18, publ. 21.08.1984]. The closest to the proposed strain is a strain of Fusarium frost Schwabe ATCC 20334 [US 4347, AN 15/00, publ. 12.12.1978], currently identified as Fusarium venenatum ATCC PTA-2684 [Wendy T. Yoder and Lynne M. Christianson, 1998. Species-Specific Primers Resolve Members of Fusarium Fusarium section. Taxonomic Status of the edible "Quom" Fungus Reevaluated.// Fungus genetics and biology, Vol.23, pp.68-80], to Liferay in deep conditions on different carbon substrates (glucose, maltose, cane molasses, starch-containing substrates and their hydrolysates). The maximum rate of growth of the producer strain in the deep culture is 0,28 h-1[Anthony P.J. Trinci, 1992. Myco-protein: A twenty-year overnight success story.// Mycol. Res. - 1992. Volume 96(1). - pp.1-13]. Mass fraction of crude protein in the biomass ranges from 45 to 54% (total nitrogen by Kjeldahl - from 7.2 to 8.6%, the conversion factor and 6.25). The disadvantage of this strain is relatively high content in the lipid fraction of the biomass palmitic acid (13 g/kg AFM) [Mycoprotein GRAS Notification, 2001], which limits the amount of product consumed in the diet because palmitic acid promotes an increase in blood cholesterol of low density and subsequently causes diseases such as thrombosis, atherosclerosis, diseases of the cardiovascular system [R.J. Nicolosi Effects of specific fatty acids (8:0, 14:0, cis-18:1, trans-18:1) on plasma lipoproteins, early atherogenic potential, and LDL oxidative properties in the hamster. /R.J. Nicolosi, T.A. Wilson, E.J. Rogers, Kritcheysky D// The journal of lipid research. - 1998. Volume 39(10). - pp.1972-1980]. The relative content of valuable unsaturated fatty acids in the biomass is relatively low and amounts: oleic (C18:1) - 14%; linoleic (C18:2) - 43%; linolenic (C18:3is 9%, and the total number of unsaturated fatty acids is 78% of total fatty acids. Another disadvantage of the proposed strain value is the content of RNA in biomass (from 7 to 12% AFM), that significantly reduces permissible for human consumption amount of biomass (not more than 2 g per day) and requires a stage of denuclearization.

Thus, at present, not known producing strains of food protein biomass capable of high-speed growth to accumulate high protein biomass with a high number of valuable unsaturated fatty acids and a relatively low content of nucleic acids.

Disclosure of inventions

A new strain of Fusarium sambucinum D-104 is characterized by a high maximum specific growth rate under conditions of liquid-phase submerged culture (from 0.28 to 0.32 h-1), a high content of proteins in biomass (from 50% to 63% AFM) and an increased number of valuable unsaturated fatty acids (from 83 to 87% of the sum of fatty acids). Strain provides a low content of nucleic acids in biomass (from 4 to 5% AFM).

A strain of Fusarium sambucinum Fuck. var. ossicolum (Berk. et Curt.) D-104, deposited in the collection PMBC number F-1161, selected on the basis of productivity during submerged cultivation on starch-containing environments, strain D-002, obtained in 1981 as the strain BWA-917, deposited in the collection PMBC number F-169 as Polyporus squamosus and subsequently identified as Fusarium sambucinum Fuck. var. ossicolum (Berk. et Curt.) Bilai. Thus, a strain of F. sambucinum D-104 (VKPM F-1161) which is closely related non-pathogenic methoxynaphthalene strain Fusarhim sambucinum BWA-917 (VKPM F-169), as confirmed in PCR fingerprint.

Cultural-morphological and physiological-biochemical characteristics of the strain. On agar wort (7°Ball) colonies in the early growth of grayish-white color with a well-developed flocculent-felt aerial mycelium. With time in the light acquires a pinkish hue. The edge of the colony is less dense, slightly pressed. The size of the colonies on agar wort at a temperature of 28°C over 4 days is 68-70 mm Aerial mycelium is well developed, grayish-white color, then rosweyde. When aging becomes a light pinkish-brown color, then ohranie shades to light brown. Sporodochia and pinotti does not form. Substrate mycelium is not painted. Reversum unchanged. Pigments in the environment does not exude, exudate does not form.

The strain grows on glycopeptides agar, glucosamina agar, mesopatamia agar, environment Saburo. On mesopatamia agar substrate mycelium aerial mycelium weak, decumbent, the edge of the colony is pressed. Diagnostic environments (rice, potato), purple, lilac, crimson shades are missing. Rice forms the mycelium salmon color, which when aging becomes ohranie shades to dark brown, rice paints in brown tones. On the slices of potato forms a pinkish, during aging olive-ochre is hydrated to dark brown mycelium.

On agar wort hyphae of the aerial mycelium hyaline, with a diameter of 2.5-5.0 µm. In the growing zone of colonies hyphae at an early age phase, smooth, long, or a fine-grained homogeneous cytoplasm, with a small amount of vacuoles, with a distinctly prominent cell walls. Branching at acute angle. The tips of the hyphae rounded. In the aging part of the colonies hyphae in late age phase, inlaid drops of oil, then differentiation of the cytoplasm in the form of large structures (vacuoles, lipid inclusions). In the later phases hyphae of different diameters, differing in 2-4 or more times (2.5-3.5 µm to 12 µm). There are swellings on hyphae and chlamydospores. Chlamydospores apical and intercalary in the glomeruli, the nodes and chains, ocher-brown, rounded, smooth, 8-12 microns.

Conidial sporulation in the form of macroconidia and microconidia on aerial mycelium, sometimes in the deep culture. Macroconidia hyaline fusiform and sickle (slightly curved), often with 3-5 septa, without constrictions. Sizes 30-50×5 μm. Sickle-shaped spores with a strong leg, upper cell gradually, evenly narrowed, slightly bent, elongated. Microconidii unicellular or 1-3 septate, oblong or fusiform. Sclerotia does not form.

During submerged cultivation in a nutrient medium with chalk soy hyphae in the exponential growth phase, young, long, with homogeneous cytoplasm and distinctly prominent cell walls. At a low speed mixing mycelium presents free hyphae and agglomerates hyphae. The end of the hyphae rounded, kapleobrazovanie or swollen. Then you receive the differentiation of the cytoplasm (lipid inclusions, vacuoles), which with the age of the culture increases. Appear large vacuoles. In the aging culture hyphae tortuous, irregular, differentiation of cell content strongly expressed, appear thickening of the hyphae and the signs of the accumulation of metabolites in the culture medium, metabolic plaques on hyphae, inlay metabolites. During prolonged storage, the formation of chlamydospores in chains. The end of hyphal growth. In the field of view there are empty cells.

Physiological and biochemical characteristics. Aerobe. Actively growing in the temperature range from 22 to 34°C, in the range of pH 3.5-7.0mm. The optimum temperature of cultivation (27±1)°C. Utilizes glucose, fructose, sucrose, xylose, lactose, galactose, maltose, raffinose and mannitol, xylitol, ethanol, glycerin. Starch hydrolyses. For nitrogen nutrition uses peptone, urea, ammonium salts, nitrates. Growth does not require amino acids. Has a high rate of growth in the deep culture on media with products of various types of grain (wheat, R is Zh, triticale), potatoes, sugar beet and cane juices of roots and green parts of Jerusalem artichoke, turnip, red beet, and other species and their hydrolysates.

The applicability of this strain is illustrated by examples.

Example 1

Culture of a strain of Fusarium sambucinwn D-104 was kept mowed wort agar in test tubes at a temperature of +4°C with periodic re-seeding every 6 months. Growing inoculum was performed in aseptic conditions at a temperature of 26 to 28°C in katalozhnyh flasks of 250 ml containing 100 ml of nutrient medium of the following composition: sucrose - 30.0 g/l, corn steep - 10.0 g/l, NH4NO3- 3.0 g/l, KH2PO4- 1.0 g/l, MgSO4·H2O - 0.1 g/l ZnSO4·H2O - 0.01 g/l, tap water - the rest, pH of 5.8 by reseeding culture with a solid nutrient medium (jamb) at the rate of 1 the casing 1 catalogno flask - the first passage. The duration of the growing seed: the first passage 96 h, the second 48 h, the third and subsequent 24 hours

Deep cultivation was carried out in periodic mode in a fermentation apparatus 30 l working volume of 20 l at a temperature of 26 to 28°C, initial pH value of 5.8, a gauge pressure of 0.4 ATM, aeration under sterile conditions 1.0 l/l/min with mechanical stirring at 400 rpm with a stirrer turbine type N. the nutrient medium of the above composition. Wednesday was inoculable mycelial suspension (the second and subsequent passages) in the amount of 10% by volume.

The growth rate of the culture of the producer strain was 0.28 h-1.

The chemical composition of biomass, % ACM:

Total protein - 56,5;

Lipids - 7,8;

Nucleic acids of 4.1.

The content of unsaturated fatty acids amounted to 83.5% from the sum of the LCD.

Example 2

Growing inoculum was performed in aseptic conditions at a temperature of 26 to 28°C in katalozhnyh flasks of 250 ml containing 100 ml of nutrient medium of the following composition: molasses beet - 40,0 g/l (2% PB), ammonium nitrate - 3.0 g/l, potassium phosphate one-deputizing - 1.2 g/l, tap water - the rest, pH of 5.8 by reseeding culture with a solid nutrient medium (jamb) at the rate of 1 the casing 1 catalogno flask - the first passage. The duration of the growing seed: the first passage 96 h, the second 48 h, the third and subsequent 24 hours

Deep cultivation was carried out in periodic mode in a fermentation apparatus 30 l working volume of 20 l at a temperature of 26 to 28°C, with the initial pH value of 5.8 (a gauge pressure of 0.4 ATM, aeration under sterile conditions 1.0 l/l/min with mechanical stirring at 400 rpm with a stirrer turbine type) on a nutrient medium of the following composition: molasses beet - 40,0 g/l (2% PB; NH4NO3- 3.0 g/l, KH2PO4- 1.2 g/l, propanol B-400 - 0.4 g/L. Wednesday was inoculable mycelial suspension (second and subsequent passages) in the amount of 10% by volume.

The growth rate of the culture of the producer strain was 0.28 h-1.

The chemical composition of biomass, % ACM:

Total protein - 60,5;

Lipids - 6,9;

Nucleic acid - 4,5.

The content of unsaturated fatty acids amounted to 84.7 per cent of the sum of the LCD.

Example 3

Growing inoculum was performed in aseptic conditions at a temperature of 26 to 28°C in katalozhnyh flasks of 250 ml containing 100 ml of nutrient medium of the following composition: wheat starch 30 g/l, NH4NO3- 4.5 g/l KH2PO4- 1.8 g/l, corn steep condensed - 10 g/l, tap water - the rest, pH of 5.8 by reseeding culture with a solid nutrient medium (jamb) at the rate of 1 the casing 1 catalogno flask - the first passage. The duration of the growing seed: the first passage 96 h, the second 48 h, the third and subsequent 24 hours

Deep cultivation was carried out in periodic mode in a fermentation apparatus 30 l working volume of 20 l at a temperature of 26 to 28°C, pH strirovaniya when the value of 4.0 (a gauge pressure of 0.4 ATM, aeration under sterile conditions 1.0 l/l/min with mechanical stirring at 400 rpm with a stirrer curb the frame type) on a nutrient medium of the following composition: wheat starch - 30.0 g/l; ammonium nitrate - 4.5 g/l; potassium phosphate one-deputizing - 1.8 g/l; corn steep condensed - 10.0 g/l, propanol B-400 - 0.4 g/l Starch was subjected to preliminary hydrolysis by enzyme preparation, aminocoumarin in the calculation 0,024% by volume of nutrient medium (4.8 g/l). Wednesday was inoculable mycelial suspension (second and subsequent passages) in the amount of 10% by volume.

The growth rate of the culture of the producer strain was 0,32 h-1.

The chemical composition of biomass, % ACM:

Total protein - 63,0;

Lipids - 6,2;

The nucleic acid to 5.0.

The content of unsaturated fatty acids accounted for 87.0% of the sum of the LCD.

The amino acid composition of the biomass producer strain is close to ideal protein FAO/who (table 1). There is a slight limitation for sulfur-containing amino acids (methionine, cystine), while the biomass of the strain enriched in lysine, which allows to combine it with deficient in this amino acid in cereals components to achieve a balanced amino acid composition of the product.

Table 1
Essential amino acidsThe content of amino acids in the ideal protein FAO/who % of the amount of amino acidsThe content of amino acids in the biome the SSE strain F.sambucinum, in % of the amount of amino acids
Leucine7,07,0
Isoleucine4,04,0
Lysine5,58,0
Methionine+cystine3,53,0
Phenylalanine+tyrosine6,08,0
Tryptophan1,01,0
Threonine4,06,0

Valine5,06,0

Lipid fraction of the mycelium of the strain Fusarium sambucinum D-104 contains a significant amount of phospholipids (up to 33% of the total lipids), which indicates its nutritional adequacy. The total amount of polyunsaturated fatty acids ranges from 83 to 87% of the total fatty acids in the biomass, which is greater than that in strain-analog (content of polyunsaturated fatty acids in strain Fusarium frost Schwabe ATCC 20334 is 78% to the total amount of fatty acids). The composition of unsaturated fatty acids brings lipid complex biomass to the most valuable vegetable oils, particularly soybean oil and wheat germ oil (table 2).

Table 2
Lipid fraction of soybean oil, % from the sum LCDLipid fraction of the oil of wheat germ, % from the sum LCDLipid fraction of the biomass of the strain F.Sambucinum, % from the sum LCD
Palmitoleic--0,8-1,1
Oleic24,021,021,0-23,0
Linoleic52,052,051,0-52,0
Linolenic9,010,08,0-9,0
Arachidonic--1,5-1,7
Itarakidzwa- 0,8-1,0

A strain of Fusarium sambucinum VKPM F-1161 producer protein food biomass.



 

Same patents:

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology. Claimed is method of obtaining food fungal biomass with high protein content. Multicycle deep cultivation of Fusarium sambucinum All-Russian collection of industrial microorganisms F-1161 on liquid nutritional medium, containing sources of carbon, nitrogen, mineral salts, separation and drying of wet fungus biomass are carried out. Cultivation is performed at pH from 3.5 to 7.0 under conditions of air aeration from 0.5 to 2.0 l/l/min. Temperature mode in each cycle of fermentation is supported from the beginning of the cycle to the point of switch at the level from 26 to 30°C, and further to the end of the cycle at the level from 22 to 25°C. Point of switch is determined by accumulation of biomass to concentration from 45 to 60% from maximally achievable in fermentation apparatus, or point of switch is determined by concentration of dissolved oxygen by its reduction to the value from 20 to 40% of saturation ( calculated per atmospheric air pressure).

EFFECT: invention makes it possible to obtain the largest accumulation of biomass with high protein content with specified quantity of nucleic acids.

4 ex

FIELD: biotechnology.

SUBSTANCE: growing of Staphylococcus aureus is carried out in a nutrient medium containing yolk-salt agar. At a stage of preparation for analysis the growth stimulators of Staphylococcus aureus are introduced into the nutrient medium in the form of aqueous solutions at concentrations of 10-4-10-6 wt %. The following compounds are used as growth stimulators: tris(2-hydroxyethyl)ammonium 4-chlorophenyl-sulfanylacetate or tris(2-hydroxyethyl)ammonium 2-chlorophenyloxyacetate or tris(2-hydroxyethyl)ammonium 2-methyl-4-chlorophenyloxyacetate or tris(2-hydroxyethyl)ammonium 1-benzylindol-3-yl-sulfanylacetate.

EFFECT: invention enables to accelerate growing of Staphylococcus aureus for diagnostics of infections, by reducing the time of growing from 48 to 6-9 hours in comparison with the control in a standard nutrient medium.

2 tbl, 7 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology and deals with recombinant strain of E. coli TG1(pRVMoscow3253G-L) for obtaining PCR-standards for quantitative determination of cDNA of rabies virus of strain "Moskva 3253".Recombinant strain is created on the basis of strain of E. coli TG1 by transformation with plasmid pRVMoscow3253G-L. Plasmid is obtained by ligation of fragment G-L of the region of genome of fixed rabies virus of strain "Moskva 3253", which has sequence SEQ ID NO1, into plasmid pGem-T. Also claimed is set of PCR-standards for quantitative determination of cDNA of rabies virus of strain "Moskva 3253" in rabies antigen. Set contains solutions of plasmid pRVMoscow3253G-L DNA in concentrations 108, 107, 105, 103 GE/ml. Concentration is determined by method of polymerase chain reaction, with hybridisation-fluorescence account of results.

EFFECT: invention contributes to standardisation of stage of preparation of rabies antigen in production of heterological anti-rabies immunoglobulin.

2 cl, 3 dwg, 2 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biochemistry and molecular biology. Conservation of cells of Escherichia coli in presence of buffered 80-90% glycerol is performed. Cell envelopes are removed with 3% triton X-100. Cell supramolecular structures are successively extracted with increasing concentrations of salts: 0.14 M (bacterioplasm), 0.35 M (loosely linked with cell residue), 2 M NaCl (strongly linked with cell residue), and 6 M guanidine hydrochloride with 0.1% β-mercaptoethanol (cell residue). Acid hydrolysis is carried out in said fractions. Anthrone method is carried out, with preliminary purification of anthrone preparation. Calibration graph is built and quantity of hexoses is determined by means of calculation formula.

EFFECT: invention makes it possible to determine quantity of hexoses in supramolecular structures of bacterial cell of Escherichia coli.

3 dwg, 3 tbl, 1 ex

FIELD: biotechnology.

SUBSTANCE: invention is production of the nutrient medium, which creates optimal conditions for growing legionella, comprising: enzymatic hydrolyzate of pig lung, enzymatic hydrolyzate of chicken egg yolk, potassium monophosphate, trihydrate disubstituted potassium phosphate, L-cysteine hydrochloride, activated carbon, microbiological agar and distilled water at a predetermined ratio of ingredients.

EFFECT: invention enables to produce the high-quality, easy-to-prepare nutrient medium, to reduce the time of growing legionella.

FIELD: biotechnologies.

SUBSTANCE: nutritive medium includes lactoserum, yeast autolysate, acetic acid 70%, agar and cabbage brew at the specified component ratio.

EFFECT: invention allows increasing selectivity of nutritive medium and simplifying its production.

8 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology and can be used in biological treatment of waste water from electroplating plants from heavy metal salts. The method involves adding yeast biomass to waste water, said biomass being in form of brewery wastes containing a combination of yeasts of different strains of Saccharomyces cerevisiae with viability of 90-95% in a given amount. The biomass is mixed with the waste water to obtain a suspension. The obtained suspension is held for 8 hours at temperature of 10°C-29°C and solution pH of 5.5-8.0, followed by recycling spent yeast containing heavy metals by treating with lime Ca(OH)2, with the ratio of yeast biomass to lime of 1:5-8, to obtain a mixture. The obtained mixture is subjected to wet treatment at temperature of 90°C for 1 hour, followed by isolation of the obtained mixture, which contains heavy metals, in concrete paste.

EFFECT: invention increases efficiency of purifying waste water from heavy metal ions.

3 tbl, 3 ex

FIELD: biotechnologies.

SUBSTANCE: invention presents a diagnostics method of sensitivity of M. tuberculosis (MBT) to injection antituberculous preparations of a reserve row. The method involves a DNA extraction stage, amplification of the investigated DNA sections by means of a polymerase chain reaction method and analysis of conformational polymorphism of single-chain fragments (SSCP). Gene section rrs is amplified in 50 mcl of a reaction mixture with addition of 5 mcl of the specimen. Promoter gene section eis is amplified in 30 mcl of the reaction mixture containing direct 5'CGGAGCCGTCGGGGTATGC and reverse 5'GCCGCGGCCAGTAGGAACA primers and 3 mcl of the specimen as per the amplification programme: 1-st stage - 95°- 4 min; 2-nd stage - 95° - 20 sec, 59° - 30 sec, 72° - 20 sec (30 cycles); 3-rd stage: 72° - 4 min; 10° - storage. Separation of amplification products in the ratio of 4 mcl of the specimen and 6 mcl of a denaturing dye is performed by electrophoresis in 8% polyacrylamide gel with 5% glycerin at voltage of 400 Volts during 5 hours at 8°C. Gel painting is performed by means of caustic silver.

EFFECT: invention allows diagnosing sensitivity of M tuberculosis to injection antituberculous preparations of a reserve row with high accuracy.

2 dwg

FIELD: biotechnologies.

SUBSTANCE: invention proposes an association of strains of bacteria-oil decomposers, which have been extracted from oil-contaminated soil, Acinetobacter species B-1037, Pseudomonas species B-989, Bacillus species B-1040, deposited at The State Research Centre of Virology and Biotechnology VECTOR. Besides, at least 30% bacteria of each strain is contained in the association. Remediation of oil-contaminated soils includes water suspension of lyophilic dried biomass of the strain association based on 109 cells per square metre. Strains of the association can utilise a wide range of oil components at the temperature of 10-15°C.

EFFECT: improving cleaning efficiency of oil-contaminated soils.

2 cl, 5 dwg, 2 tbl, 4 ex

FIELD: biotechnologies.

SUBSTANCE: bacillus subtilis subsp.subtilis BKM B-2711D strain has apparent antagonism in relation to Escherichia coli, Salmonella typhi, Staphylococcus aureus, Listeria monocytogenes, and resistance to streptomycin and tetracycline antibiotics. It is deposited in the All-Russia Collection of Microorganisms of the Institute of Biochemistry and Physiology of Microorganisms Named after G.K. Skryabin of the Russian Academy of Science (IBFM RAN) and has the following registration number: BKM B-2711D, and can be used at production of probiotic bacterial preparations that can be used in veterinary medicine.

EFFECT: invention allows increasing protease and xylanase activities.

1 tbl, 3 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology. Claimed is method of obtaining food fungal biomass with high protein content. Multicycle deep cultivation of Fusarium sambucinum All-Russian collection of industrial microorganisms F-1161 on liquid nutritional medium, containing sources of carbon, nitrogen, mineral salts, separation and drying of wet fungus biomass are carried out. Cultivation is performed at pH from 3.5 to 7.0 under conditions of air aeration from 0.5 to 2.0 l/l/min. Temperature mode in each cycle of fermentation is supported from the beginning of the cycle to the point of switch at the level from 26 to 30°C, and further to the end of the cycle at the level from 22 to 25°C. Point of switch is determined by accumulation of biomass to concentration from 45 to 60% from maximally achievable in fermentation apparatus, or point of switch is determined by concentration of dissolved oxygen by its reduction to the value from 20 to 40% of saturation ( calculated per atmospheric air pressure).

EFFECT: invention makes it possible to obtain the largest accumulation of biomass with high protein content with specified quantity of nucleic acids.

4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology. Disclosed is a purified preparation of recombinant human N-acetylgalactosamine-6-sulfatase (GALNS) enzyme, where said enzyme includes an amino acid sequence which is at least 95% identical to amino acids 27-522 SEQ ID NO:4, which is suitable for treating a subject suffering from a lysosomal storage disease associated with GALNS, where: (a) said GALNS enzyme preparation has purity of at least about 95% as determined by Coomassie Blue staining when subjected to SDS-PAGE under non-reducing conditions; and (b) the cysteine residue at position 79 of at least 50% of molecules of the GALNS enzyme in said GALNS enzyme preparation is converted to Cα-formylglycine (FGly); where said GALNS enzyme is N-linked glycosylated at the asparagine residues at positions 204 and 423, wherein at least about 50% of the oligomannose chains attached to the asparagine residue at position 204 are bis-phosphorylated. Disclosed is a method of treating a subject suffering from mucopolysaccharidosis type IVa (MPS IVa), Morquio A syndrome or multiple sulfatase deficiency (MSD), which involves administering a therapeutically effective amount of said purified preparation of recombinant human GALNS to the subject.

EFFECT: invention enables to obtain a pharmaceutical preparation of recombinant highly phosphorylated human GALNS, having a high content of molecules with a cysteine residue at position 79 converted to Cα-formylglycine, owing to which it is highly absorbed through the mannose-6-phosphate receptor (MPR) and has high activity.

29 cl, 13 dwg, 15 tbl, 11 ex

FIELD: biotechnologies.

SUBSTANCE: mutant strain is obtained by impact on Glarea lozoyensis ATCC 20957 strain by nitrosoguanidine and it is deposited in CGMCC with number CGMCC 2933.

EFFECT: fungi strain has stable genetic and productive properties, produces low quantity of impurities during fermentation and is acceptable for commercial production of antibiotic.

6 cl, 2 dwg, 2 tbl, 3 ex

FIELD: biotechnologies.

SUBSTANCE: there proposed is an antibody specific to TENB2 containing light and heavy chains. Heavy chain contains substitution for free (reaction capable) cysteine A121C that corresponds to A114C (Kabat numbering) or A118C (Eu numbering). Conjugate versions are proposed for prostate cancer treatment containing antibody covalently bound to auristatin, also by means of linker. The following is described: pharmaceutical composition for prostate cancer treatment that uses as active beginning the antibody or its conjugate; product for prostate cancer treatment on the basis of such composition. The invention proposes: method for defining protein TENB2 in the sample - on the basis of antibody as well as analysis for revealing prostate cancer cells at mammal and method for cell proliferation inhibiting on the base of antibody conjugate and auristatin. There described is the method for obtaining antibody conjugate (Ab) and auristatin (D) with expression Ab-(L-D)p, where p is equal from 1 to 4, and L is linker.

EFFECT: invention application provides conjugates with increased stability in serum in comparison with the same conjugates without A121C substitution in antibody that can be used in medicine.

33 cl, 18 dwg, 2 tbl, 4 ex

FIELD: biotechnologies.

SUBSTANCE: expression vector includes: (a) replication origin OriP obtained from Epstein-Barr virus (EBV), where replication origin contains: 1) symmetry element of the second order (DS); and 2) duplication section (FR) that contains fixation point EBNA; (b) replication origin SV40; (c) insertion section for inserting a gene of concern; (d) promoter EF-1b functionally bound to the insertion section; (e) poly-A signal; (f) bacterial replication origin; (g) selected marker; and unnecessarily containing (h) sequence of nucleic acid, which codes constant area of heavy or light chain of antibody, which is functionally bound to the insertion section. With that, replication origin OriP is bound to an initiation factor of replication EBNA 1, which acts from outside and is not coded with an expression vector.

EFFECT: use of an expression vector in an extracted host cell, a set and a method for obtaining recombinant protein provides production of abundant protein expression.

26 cl, 25 dwg, 3 tbl, 4 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes a method for obtaining recombinant core protein of hepatitis E virus (rtHEV-ORF2) and recombinant vaccine for prophylaxis of hepatitis E virus. Core protein is obtained by cultivation of recombinant yeast strain Hansenula polymorpha "КБТ"-11/pHEV-001, which contains DNA sequence integrated into genom of yeast cell and coding the fragment of amino-acid sequence from position 86 to 607 of core protein of hepatitis E virus of genotype 3 (rtHEV-ORF2) under control of promoter of MOX gene. The method allows obtaining immunogenic antigene of hepatitis E virus, which has properties of natural protein. Based on the obtained antigene there created is recombinant vaccine for prophylaxis of hepatitis E virus. Vaccine includes effective amount of rtHEV-ORF2 protein, adjuvant and a physically acceptable diluter.

EFFECT: vaccine is immunodominant and non-toxic and has no by-effects.

3 cl, 5 ex

FIELD: biotechnologies.

SUBSTANCE: renatured membrane protein obtaining method is proposed. The above method involves production of a homogeneous solution containing a denatured membrane protein, a detergent mixture, phospholipide or phospholipide mixture and apolipoprotein or its equivalent with: further removal of detergents and formation of lipid-protein nanodiscs (LPND) containing renatured protein.

EFFECT: method provides production of renatured membrane proteins with high yield, which are built into LPND, which can be used at development of new medical products, biocatalysts, biosensors and biophotonic devices.

8 dwg, 2 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes a production method of recombinant protein through its hybrid precursor substance with natural decomposition site with enteropeptidase. The result is achieved by replacement in natural decomposition site with enteropeptidase Asp-Asp-Asp-Asp-Lys of amino-acid residue of lysine (Lys) with amino-acid residue of arginine (Arg) and further decomposition of hybrid precursor substance with light catalytic subunit of enteropeptidase of a human being or a bull.

EFFECT: improving quality and yield of target product under conditions when hybrid protein detects additional sites of decomposition with enteropeptidase.

3 tbl, 3 dwg, 4 ex

FIELD: chemistry.

SUBSTANCE: present inventions relate to protein engineering, plant molecular biology and pest control, as well as a hybrid insecticide protein and use thereof. Described is a hybrid insecticide protein which includes from the N-end to the C-end an N-end portion of Cry3A protein which is fused with the C-end portion of Cry1Ab protein, wherein the position of the crossover of the Cry3A protein and the Cry1Ab protein is located in a conservative block 2, in a conservative block 3 or in a conservative block 4 and has anti-western corn rootworm activity. Also disclosed are nucleic acid molecules which code the novel proteins, methods of producing proteins, methods for use thereof, as well as transgenic plants and seeds thereof which contain such proteins.

EFFECT: inventions enable to obtain cheap means of controlling Diabrotica worms.

39 cl, 8 dwg, 9 tbl, 46 ex

FIELD: biotechnology.

SUBSTANCE: method is characterised in that the DNA of the structure RNAb indicated on Figure 1, which encodes the fused protein of three parts, where N-terminal position is green fluorescent protein GFP, central - peptide of 73 amino acid residues with the amino acid sequence of SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEW KDPDGMLKDHLNILVTKDIDFDT, and C-terminal - light chain of double-stranded protein Kunitz-type inhibitor from potato tubers (PKPI-BI), are introduced into cells of E. coli. The cells transformed by this construction are cultured, the biomass is lysed, the insoluble fraction of the lysate is separated by centrifugation. The product of expression in the form of inclusion bodies is solubilised with the denaturant. Chromatography is carried out under denaturing conditions. The resulting product is used for detection of specific antibodies in serum of patients with hemorrhagic fever with renal syndrome.

EFFECT: invention enables to obtain the recombinant antigen G2 of Hantavirus Dobrava with increased yield.

6 dwg, 1 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology. Claimed is method of obtaining food fungal biomass with high protein content. Multicycle deep cultivation of Fusarium sambucinum All-Russian collection of industrial microorganisms F-1161 on liquid nutritional medium, containing sources of carbon, nitrogen, mineral salts, separation and drying of wet fungus biomass are carried out. Cultivation is performed at pH from 3.5 to 7.0 under conditions of air aeration from 0.5 to 2.0 l/l/min. Temperature mode in each cycle of fermentation is supported from the beginning of the cycle to the point of switch at the level from 26 to 30°C, and further to the end of the cycle at the level from 22 to 25°C. Point of switch is determined by accumulation of biomass to concentration from 45 to 60% from maximally achievable in fermentation apparatus, or point of switch is determined by concentration of dissolved oxygen by its reduction to the value from 20 to 40% of saturation ( calculated per atmospheric air pressure).

EFFECT: invention makes it possible to obtain the largest accumulation of biomass with high protein content with specified quantity of nucleic acids.

4 ex

Up!