Russian patents diapazon from 2532500 to 2532699

2532500 - 2532549
2532550 - 2532599
2532600 - 2532649
2532650 - 2532699

	Method for prediction of right and left ventricular diastolic dysfunction in patients suffering from bronchial asthma Invention refers to medicine, namely pulmonology, allergology, cardiology, functional diagnostics. Elastic and functional properties of the aorta are assessed by analysing the pulse wave characteristics recorded by non-invasive arteriography. The derived data provide a basis to calculate the principal characteristics of an arterial rigidity: the aortal pulse wave velocity - APWV and the augmentation index - AI. If observing the APWV value of 7 m/s and more and the AI value of 30% and more, the diastolic dysfunction of both ventricles is predicted.
	Multifunctional packer Invention relates to mining, in particular to the oil producing industry, and can be used for separate exploitation of oil wells. The multifunctional packer comprises a pipe connected from above with the column of pumping and compression pipes and from below with the submersible electrically-actuated pump through the nozzle. Outside of the pipe the rubber ring sleeves with the mechanism of their extension are mounted, an anchor, a centraliser and a channel is made for tight wiring the power cable through the packer. In the wall of the pipe on both sides of the ring sleeves the radial holes are made and ring trapezoidal grooves symmetrically to them, connecting the pipe cavity with spaces between the pipes above and below the packer. The inner pipe diameter is smaller than the inner diameter of the column of pumping and compression pipes and towards the upper end of the pipe in the latter the inner cone of transition from the pipe diameter to the column diameter of pumping and compression pipes is made. On the inner side of the wall of the pipe a ring recess is made of the locking device for mounting in the pipe of removable cylindrical inserts designed to perform certain technological procedure of well operation of descending into the pipe through the cavity of the column of pumping and compression pipes and hermetically mounted in a pipe through the seals with the possibility of aligning and/or overlapping the ring trapezoidal grooves with radial holes in the pipe and in removable cylindrical inserts. In the pipe the removable cylindrical inserts can be mounted for technological operations of the procedure of operation of the well: washing the above-packer tubular annulus or washing the submersible electrically-actuated pump, or gas discharge from the under-packer tubular annulus, or oil extraction using submersible electrically-actuated pump and other removable inserts. The removable cylindrical inserts comprise the element of the retaining device interacting with mating ring recess on the inner side of the pipe wall, retaining the cylindrical insert in the pipe in a certain position, and an annular groove for engaging the removable inserts with the gripping tool for descending from the well surface to the pipe and removal them through the cavity of the column of pumping and compression pipes.
	Reverse evaporator Invention refers to medicine, particularly to medical equipment. It can be used for surgeries and postoperative care of wounds (including injuries, burns, freezing injuries and trophic ulcers), as well as soft tissues and mucous membranes for bleeding control, prevention and treatment of suppurative complications, infectious and dermatologic diseases. The object of the presented device is providing the local, targeted haemostatic and/or antiseptic preparation of biological tissues with an ozone-oxygen mixture in a combination with the effective aspiration and deactivation of ozone from the used gas mixture, staying within the maximum permissible ambient ozone concentration. The assigned object is solved by the fact that the device additionally comprises a motor and storage portions combined together into a one-piece working circuit. A tip in the form of an ozone handle and peripheral aspiration and release pumps connected by a plastic retainer; pump inlets and outlets are presented in the form of junction pipes provided with conical nozzles with adapters, are parts of the motor portion. The storage portion comprises a chain of cross-pieces coupled in the same direction by supplying pipes and provided on each side from each cross-piece with a pair of hermetic ozone-oxygen packages on the opposite crossarms.
	Method for determining degree of individual resistance to decompression disease in females at 20-30 years of age Invention refers to medicine, particularly to marine medicine. The nervous and cardiovascular functional characteristics are measured 30 minutes before and 30 minutes after a 30-metre chamber immersion to stay there for 1 hour and following 63-minute decompression. That is followed by determining an index of resistance to decompression disease (DD) in females at 20-30 years of age (IRDDF_20-30) by original formula. If the derived value of the index of resistance is less than 1, a high degree of resistance to DD is stated, and the value falling within the range of 1 to 1.8 shows a moderate degree, while a low degree of resistance to DD is stated if observing the related value exceeding 1.8.
	Method of forming laser raster Invention relates to instrument-making and is intended for forming laser raster of control systems, laser aiming devices and can be used in controlling, landing and docking aircraft, guiding ships through complex shipping channels, detecting optoelectronic devices from "flare" and remote control of robotic devices. The method of forming laser raster is based on successive diffraction of a laser beam at two acoustooptical deflectors mounted in series and turned by 90 degrees relative to each other, where high-frequency control signals f₁(t) and f₂(t) are transmitted to the control inputs of said deflectors and where the laws of variation of said signals are given in the form of linear variation of control frequencies, and the number N of rows or (and) columns is selected as an integer value based on the condition N=k·T_c/τ, where k=1.0-2.5, T_c is the row formation time, τ is the time constant of the deflector, calculated as τ=d₀/ν, d₀ is the light aperture of the deflectors, ν is the acoustic wave speed.
	Method for determining balance of chemical composition of swamp waters from their hydrodynamic conditions Invention relates to hydrodynamic and hydrochemical tests of waters of peat soils. According to the method, there determined is a law of distribution of a set of balance coefficients during different periods of unidirectional processes characterising relationship between chemical and hydrodynamic processes flowing as to thickness of a peat deposit. Flow rates of the incoming water are determined with a sampling complex. A calculation of balance coefficients of the obtained data is carried out by a unification method. They are brought to a uniform dimensionless form by a mathematical generalisation method. Change of a set of balance coefficients allows efficient assessment of a degree and dynamics of change of chemical water composition and its hydrodynamic mode due to duration and intensity of processes. Persistent interaction of balance coefficients distributed in time and depth shows balance of a swamp ecosystem.
	Method for thermal-beam treatment of tl-osl substance of solid-state ionising radiation detector based on aluminium oxide Invention relates to a method of treating working substances of solid-state ionising radiation detectors based on thermally stimulated luminescence (TL) and optically stimulated luminescence (OSL) phenomena. The method for thermal-beam treatment of substance of a solid-state ionising radiation detector based on aluminium oxide includes steps of heating material and irradiation thereof in a heated state with photon radiation with power of 1-10 mW in the wavelength range of 200-220 nm for a given time, wherein irradiation of the material in a heated state with photon radiation with said parameters is carried out in two steps, first at 550-590°C for 1-3 minutes and then at 370-400°C for 4-6 minutes.
$Free form lenses with variable refraction index$	Free form lenses with variable refraction index Free form ophthalmic lens comprises a first optical zone portion comprising multiple voxels of polymerised crosslinkable material containing a photoabsorptive component. The optical zone portion comprises a first area having a first refraction index and a second area having a second refraction index; and a second portion comprising a layered volume of crosslinkable material polymerised beyond the gel point of the crosslinkable material.
	Detection method of blockage in coriolis flow meter, and coriolis flow meter Invention relates to a method for detection of complete or partial blockage of a measurement tube (A; B) of Coriolis flow meter (2) that can be installed in a pipeline and that has a measuring converter of a vibration type at least with two in-parallel installed measurement tubes (A, B) that are favourable in hydrodynamic ratio. The method involves steps of measurement of a flow in a subset, which moves in a subset of measurement tubes (A, B), and comparison of a flow value obtained as per this measurement with an expected test value for the same subset. The test value is determined as per full mass flow rate determined within the framework of Coriolis measurement of mass flow rate. Besides, the method involves a step of detection of blockage at least of one measurement tube (A; B) of a measuring converter in case the value of the flow in the subset differs from the test value by more than one limit value.
	Fuse device for torpedoes Invention relates to military equipment, to fuse devices for marine torpedoes. The device comprises electric trigger device, a contact target sensor, a device for distant arming with two stoppers - blocking and safety with appropriate triggering devices based on the electric igniters, the device of self-destruction and the executive-detonation device. The device of distant arming and the device of self-destruction are made in the form of electronic pulse counters, inputs of which are connected through the connector pins with on-board equipment of the torpedo control, and their outputs are connected to the electronic launching appliances, made on the basis of field transistors and storage capacitors. The first counter and the first trigger device with electric igniter are electrically and kinematically connected to the blocking stopper, the second counter and the second trigger device with electric igniter - to the safety stopper, and the third counter of the self-destruction device - with the input of executive-detonation device comprising an electronic device based on the logical elements of "exclusive "or" and "3AND", which enables the triggering from the signal of the target sensors. The electronic launching appliances are made based on the field transistors and storage capacitors.
	Ceramic mixture Invention relates to compositions of ceramic mixtures which can be used in making articles for decorative and art purposes and dish ware. The ceramic mixture contains the following components, pts.wt: clay 500; burnt ochre 30-50; mica 100-130; wollastonite 10-30.
	Method of making ceramic wall article (versions) Invention relates to production of ceramic wall articles. The method of making a ceramic wall article includes preparing a ceramic mixture, plastic or semidry moulding articles with voids, drying and annealing, filling the voids with quartz-containing material, the quartz containing material used being a mixture of ground silicate glass and a gas-forming agent, taken in amount of 1-20% of the weight thereof, wherein the voids are filled before annealing the article.
	Ceramic mixture for making floor tiles Invention relates to compositions of ceramic mixtures for making floor tiles. The ceramic mixture for making floor tiles contains the following components, wt %: fire clay 62.0-68.0; bentonite 2.0-3.0; crystalline silicon production wastes 27.0-30.0; zircon 3.0-5.0.
	Sound absorbing element (versions) Invention relates to industrial acoustics and can be used for minimizing of noise of machine drives, lining of industrial premises and in other sound-proof structures. Sound absorbing element comprises a smooth surface and a perforated surface between which a multilayer sound absorbing structure is placed which consists of three layers of sound-absorbing material. The first layer is more rigid, solid and profiled and is fixed on the smooth surface. The second layer is softer than the first one, is intermittent and placed in the focus of the sound reflecting surfaces of the first layer. The third layer is made from foamed sound absorbing material, for example, construction sealing foam insulation, and is placed between the first more rigid layer and the perforated surface of the sound absorbing element.
	Binding agent, method of its production and prepreg on its basis Invention relates to the production of composite materials. The invention includes a binding agent, its application in prepregs, and a method of obtaining the binding agent. The thermosolidified binding agent contains the following components: (A) at least, one bismaleimide in a quantity from 46 to 66 wt %, (B) 4,4'-(propane-2,2-diyl)bis(2-allylphenol) in a quantity from 18 to 40 wt %; (C) at least, one substance, selected from the group, including 4'-(propane-2,2-diyl)bis(allyloxy)benzene) and bis-(4-(allyloxy)phenyl)diphenylmethane in a quantity from 2 to 15 wt %; and (D) at least, one polyimide based on aromatic diamines and dianhydrides of aromatic tetraacids in a quantity from 5 to 25 wt %.
	2,5-disubstituted arylsulphonamide ccr3 antagonists Invention relates to compounds of formula I, possessing a modulating action with respect to the CC chemokine receptor 3 (CCR3), a based on them pharmaceutical composition, versions of treatment methods and a method of controlling the CCR3 activity. In the general formula I R¹ and R² represent halogen or C_1-6alkyl; R³ represents cyano or nitro; R⁴ represents or ; R⁵ represents oxo; C_1-6alkyl, optionally substituted with halogen atoms; or C(O)OR^1a; X represents O or S; Y represents -O-, -S-, -N(R^1a)-, -C(R^1a)(R^1d)- or -C(R^1a)(NR^1bR^1c)-; m represents an integer number from 0 to 2; n represents 1; p represents an integer number from 0 to 2; r represents 1 or 2; and each R^1a, R^1b, R^1c and R^1d represents (a) hydrogen; (b) C_3-7cycloalkyl; or (c) C_1-6alkyl, optionally substituted with hydroxyl, or each pair R^1b and R^1c together with a N atom, which they are bound to, form imidazoimidazolyl, substituted with oxo, butyl or chlorine, or heterocycle, containing 5 or 6 atoms in a cycle.
	Vacuum drainage system Invention relates to the field of land reclamation and can be used for draining soils in heavy-textured soils, as well as in regulation of the water level in upper pools of bulkhead structures in irrigation and drainage-humidification channels. The system comprises an inlet 1 and an outlet 28 drains, a storage container 2 and a chamber 3 connected by the pipe 4. The chamber 3 is placed in an inspection manhole 5, in which a siphon is mounted. A float 18 is placed in an additional chamber 20 and is provided with a load 19 with a variable mass. The system comprises a three-port articulation linkage, the first port 8 of which is pivotally connected to the first horizontal axis of rotation 7. A shutter 6 is connected to the axis of rotation 7 with the ability of rotation and fixing the shutter in the end positions by means of clamps on the output head of the chamber 3 which is connected to the inlet pipe. The second port is made in the form of a rod 9 mounted on the second horizontal axis of rotation 11 and connected to a lever 10. The lever 10 is pivotally connected to a rod 12 rigidly connected to the float 18. The rod 9 by a lever 13 with a slider 14 is connected to a rack 15, on which a limiter 16 is secured using a retaining screw 17. In the bottom of the additional chamber 20 there is an inlet 23 with the located valve 24 connected to a float sensor 25. The inspection manhole 5 is equipped with a siphon made in the form of a vertically mounted cylindrical nozzle 29 connected to the outlet 28 drain, and a cap 30 located above it. The combination of the articulation linkage with the floating drive mounted on the wall of the chamber (well) with control elements enables to avoid imbalances by moving the shutter 6 on the axis 7, and the operation of the siphon also enables to adjust automatically water discharge to the outlet drain with the stable flow rate.
	Sorbent of hydrogen sulphide Invention relates to sorbents of hydrogen sulphides, which can be used for dry purification of gases. A sorbent of hydrogen sulphide contains urotropine in an amount of 1-10% on a carrier - activated coal.
	Method of separation and concentration of organic substances from liquid mixtures and device for its realisation Method of separation and concentration of organic substances by thermogradient pervaporation separation of liquid mixtures through a membrane by means of a device, containing reservoirs with a mixture to be separated and a coolant, a thermopervaporation module, which contains a flow chamber with the mixture to be separated, bounded from one side by a membrane selective with respect to the target component, a flow chamber with the coolant, bounded from one side by a solid condensation surface, a condensation chamber, located between the membrane and the condensation surface, passing through the thermopervaporation module, containing the target component, and pumps for circulation of the mixture to be separated and the coolant between respective reservoirs and the thermopervaporation module. As the permeate condensation surface used is a porous partition, with a pump for the coolant circulation being placed after the thermopervaporation module.
	Polymer-rubber waterproofing composition with reduced fire hazard and method of obtaining thereof Invention relates to polymer construction materials of a reduced fire hazard, which do not support burning, applied for sealing and waterproofing of walls, roofing, foundation, basements, swimming-pools, and reservoirs for storing fuel at petrol stations. A waterproofing composition includes a rubber dispersion - latex SKD-1C, additionally contains (co)polymers "Akremos 101" and "Akremos 106" and functional additives - decabromodiphenyloxide, aluminium hydroxide, hexabromocyclododecane, butyldiglycol acetate, pigment titanium dioxide, zinc orthophosphate.
	Adhesive composition Invention relates to an adhesive composition based on chlorine-containing polymers for gluing seams of protective suits, tents, sleeping bags, manufactured from a rubberised material. The adhesive composition includes polychloroprene rubber nairit NT, chlorinated butyl rubber CBR-139, a low-melting copolymer of ethylene with vinylacetate, silicon dioxide, vulcanising agents - altax and a molecular complex of resorcin with urotropine RU-D and an organic solvent - a nefras and ethylacetate mixture. The adhesive composition, applied on a textile substrate or on a rubberised material is used in the form of a gluing tape for sealing seams of products, manufactured from rubberised materials, by hot air.
	Method for determining risk of coronary artery atherosclerosis in patients suffering from diabetes mellitus accompanied by cardiovascular disorders Invention refers to medicine, and can be used in cardiology, endocrinology, functional diagnostics and can find application in diagnostics and selecting a therapeutic approach to ischemic heart disease. The following risk factors are detected in the patients suffering from diabetes mellitus accompanied by cardiovascular disorders: blood plasma glucose, glycated haemoglobin (HbAlc), total blood plasma cholesterol, blood plasma low density lipoprotein cholesterol, blood pressure, load St segment depression, signs of carotid wall thickening, an ankle-brachial index and brachial endothelium-dependent vasodilatation as shown by the Doppler ultrasound, duration of diabetes mellitus; the derived values are scored. The derived scored values are summed up, and a risk of coronary artery atherosclerosis is stated to be low, moderate, high or very high.
	Tattoo machine Invention refers to medical equipment and can be used for decorative and cosmetic tattooing. A tattoo machine comprises a frame and a permanent magnet. The permanent magnet is mounted to polarise a magnetic flow generated by an inductance coil. The frame of the tattoo machine is made of a non-magnetic material and comprises a holed projection. The inductance coils are arranged on both sides from the projection of the frame. The permanent magnet is cylindrical and integrated into the hole of the projection of the frame so that a magnetic axis is perpendicular to axes of the inductance coils.
	Method for creating gastroenteroanastomosis accompanying subtotal gastrectomy Invention refers to medicine, namely to surgery, and can be used in surgical management of tumours and complicated ulcers of the distal one-third of the stomach and duodenum. The Bilroth's II gastrectomy is performed. The stomach is transacted along the border of the proximal and middle one-thirds with a linear suturing apparatus from a lesser curvature. An opening 1.5 cm long is formed from an opposite end of a gastric stump. The Roux isolated enteric loop is formed. An enterotomic opening is formed at 5 cm from the stump of the Roux isolated enteric portion. One branch of the linear stapling apparatus is inserted into the gastric lumen through the provided gastrotomic opening of the stump towards a greater curvature. The second branch is inserted through the enterotomic opening towards the enteric stump. The gastroenteroanastomosis is partially formed. The rest portion of the gastroenteroanastomosis is formed between the gastric stump and the enteric enterotomic opening by an uninterrupted manual suture.
	Method for determining relation of blood flows in paired organs or paired regions of interest Invention refers to medicine, namely to functional diagnostics, and can be used in assessing the blood microcirculation status in a patient's limbs by determining a relation between the blood flows in the paired organs or paired regions of interest by radionuclide diagnostics. That is ensured by inserting a microcatheter with a two-way cock and two syringes attached, into the ulnar or other forearm vein. One syringe contains an indicator, an amount of which shall not exceed 0.3-0.5 ml, while the other syringe contains normal saline. Immediately after the indicator is introduced into the catheter, it is pushed on by normal saline from the second syringe. A camera is used to record gamma emission and a radioactivity-time curve is constructed. The radioactivity-time curves are rated by an area of the specified regions of interest y1(t)/S₁, y2(t)/S₂ to construct the initial radioactivity-time curves y1(t), y2(t), which are approximated by orthogonal polynominals α1(t), α2(t) in the form of a parametric curve ψ[α1(t), α2(t)], whereon a straight-line segment is specified between the points t₁ and t₂ for the following approximation implemented by the least square method and represented by the straight line y=kx+b. Herewith, y is an approximated radioactivity in the 1^st region of interest , x is an approximated radioactivity in the 2^nd region of interest, k=tgα, wherein α is an inclination of the straight line to an absciss, b is a segment of the y axis from the coordinate origin to a crossing point of the straight line and the y axis. The required relation D is defined as wherein Q₁ is the blood flow (ml/min) in the 1^st region of interest, Q₂ is the blood flow (ml/min) in the 2^nd region of interest.
	Exogenic-induced animal model of alzheimer disease Invention refers to experimental medicine and concerns modelling Alzheimer disease. That is ensured by using B6C3-Tg(APPswe,PSEN1dE9)85Dbo/J oncomice. A preparation containing a synthetic analogue of aspartic acid isomerised in an amino acid residue in position 7 of human beta-amyloid with the amino acid sequence DAEFRH[isoD]SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) and/or fragments thereof containing the isomerised aspartic acid residue in position 7 [isoD] into the animal's blood-vascular system. The preparations are administered in a dose of 100 mcg, in 200 mcl/head of the solution once a month.
	Method for determining axial position of toric intraocular lens before implantation Invention refers to medicine, namely to ophthalmic surgery, and can be used to determine an axial position of a toric intraocular lens before implantation. A mark, which is an output point from scleral vessels on the eyeball surface, is found on a keratotopogram. A strong corneal axis is localised in relation to the above mark. That is followed by an intraoperative localisation of the strong corneal axis guided by the visualised mark. The presented corneal axis is marked. The toric intraocular lens is implanted which is guided by its working axis in relation to the mark and aligned with the marked strong corneal axis.
	Harq adaptation for acquisition of neighbour cell system information Method includes receiving, by a mobile station, a request from a serving cell for acquisition of system information of a neighbour cell, the request including at least a physical cell identifier and a time limit for acquisition of the system information of the neighbour cell, acquiring the system information of the neighbour cell within the time limit for the acquisition of the system information, and reporting at least a part of the acquired system information to the serving cell.
	Electromagnetic torque control device for alternating-current two-phase motor Invention is related to the area of electric engineering and may be used for electromagnetic torque control of alternating-current two-phase squirrel-cage induction motor. Excitation winding of the squirrel-cage motor is coupled to the alternating-current power supply in series connected through a compensating load unit, which, in its turn is connected in parallel with a switching unit. Input of the switching unit is coupled to output of the amplification coefficient control device, which is coupled to the first input of the amplifier with controlled amplification coefficient. Input of the amplification coefficient control device and the second input of the amplifier with controlled amplification coefficient are coupled to the voltage control source and output of the amplifier with controlled amplification coefficient is coupled to input of the power amplifier, which is connected in parallel to the control winding.
	Radio communication resource selection method, radio communication base station and mobile station Invention relates to wireless communication. The method of selecting a radio communication resource according to the present invention is intended for selection of a radio communication resource to be allocated to an uplink acknowledgement signal which indicates the reception state of a downlink signal from a plurality of radio communication resources defined by frequency and code. The method includes a step of designating a plurality of radio communication resources by first information on an uplink radio communication resource; a step of designating one radio communication resource by second information on an uplink radio communication resource; and a step of selecting one allocated radio communication resource designated by the second information among a plurality of radio communication resources designated by the first information as a radio communication resource for allocation to the uplink acknowledgement signal.
	Fission nuclear reactor having flow control assembly Flow control assembly is connected to a nuclear fission module capable of producing a travelling burn wave at a location relative to the nuclear fission module. The flow control assembly controls flow of a fluid in response to the location relative to said nuclear fission module. The flow control assembly comprises a flow regulator subassembly configured to operate according to an operating parameter associated with said nuclear fission module. Furthermore, the flow regulator subassembly is reconfigurable according to a predetermined input into the flow regulator subassembly. Also, the flow control assembly comprises a carriage connected to the flow regulator subassembly for adjusting the flow regulator subassembly to vary fluid flow into said nuclear fission module.
	Method of signalling specific types of resource elements in wireless communication system Method can include receiving (610) a message providing information on a set of allocated resource elements carrying data intended for a wireless terminal. The method can include receiving (620) an indication corresponding to a resource element of a specific type within the set of allocated resource elements. The method can include decoding (630) resource elements which carry data intended for the wireless terminal based on the message providing information and based on the indication.
	Method and device for electric motor start-up Invention is attributed to the field of electric engineering and may be used for electric motor start-up. Start-up method for the electric motor (100) with a rotor includes the following stages: rotor rotation in the first direction by means of the first torque, at that maximum value of the first torque does not exceed maximum value of torque counteracting the rotor rotation so that the rotor is braked in the first idle position; rotation of the rotor in the first idle position in the second direction opposite the first one until the rotor is braked in the present second idle position and start-up of rotation for the rotor in the second idle position in the first direction of rotation.
	Mobile communication method Invention relates to mobile communication. The mobile communication method includes a step in which, when it is detected that a mobile station (UE) has moved into a cell #1 inside an area to be measured, an MME transmits to a wireless base station eNB#1 which manages the cell #1 a measurement configuration #1 required for performing measurement and reporting of a desired wireless communication quality; and a step in which the wireless base station eNB#1 transmits an "RRC Connection Reconfiguration" containing the measurement configuration #1 to the mobile station (UE).
	Device for transmission of three-phase electrical energy through double-wire line Invention is related to the area of electric engineering, and namely to the method of transmission of three-phase electrical energy through double-wire line. The device comprises a three-phase step-up transformer, which primary windings are coupled to the supply network while its secondary windings are coupled to the electric energy converter coupled to the transmitting double-wire line, which secondary windings are coupled to the electric energy converter supplying the three-phase receiving network. The first and second secondary windings of the three-phase step-up transformer are interconnected in series opposition and the third secondary winding is connected to the first one in series aiding, at that between beginnings of the first and second windings there is an adjustable capacitor bank to which the double-wire transmission line is connected and in-series with the third winding there is the second adjustable capacitor bank, second ends of the double-wire line are connected to the adjustable capacitor bank mounted between beginnings of the first and second windings interconnected in series opposition while the third winding of the step-down three-phase transformer is connected in series with the adjustable capacitor bank and in series with its first winding, at that wye-connected secondary windings of the step-down three-phase transformer are coupled to the three-phase user. In the other version of the invention primary windings of the step-up three-phase transformer are wye-connected and between beginnings of primary windings there are adjustable capacitor banks, and its first and second secondary windings are interconnected in series opposition, while the third one is in series aiding, to the beginnings of the second and third windings the double-wire transmission line is connected and to the line ends beginnings of the second and third windings of the three-phase step-sown transformer are connected in series aiding, its secondary windings are wye-connected and between beginnings of the windings there are adjustable capacitor banks.
	System for detecting unauthorised use of portable electronic devices Invention relates to recording time spent by a person, specifically to monitoring mobile workers in companies with a large staff and many branches and separate subdivisions. Biological information on pulse waves of all workers in the system from their sensors 1 is transmitted to a base terminal 2 and signals from all sensors 1 at certain moments in time are compared with each other in a comparison unit 3. If no matches of information from the sensors 1 are found, the comparison unit outputs a signal to a display unit 4, which indicates the number of sensors 1 which matches the number of workers in the system. If a complete match or other link between signals from two or more sensors 1 is detected, then said sensors are on the body of one person. In that case, the comparison unit 3 outputs a signal to a display unit 5, which displays unauthorised use of specific sensors by a certain worker in the system.
	Control system of air coolers Invention relates to fan installations of adjustable performance. The control system of air coolers comprises regulators, temperature sensors, fans and heat exchangers in air coolers, as well as the inlet collector and the outlet collector for the cooled medium. The system additionally comprises a temperature sensor of the cooled medium, mounted on the inlet collector, a temperature sensor of the chilled medium, mounted on the outlet collector, and the administrator of the upper level, electrically connected to all the air cooling units of the system, and also with the temperature sensors of the cooled medium and the chilled medium, mounted on the inlet and outlet collectors. The administrator of the upper level is engaged in the system work exclusively in the event of planned or emergency shutdown of one or several air coolers.
	Method for electroslag melting of steel so that hollow ingot is obtained Invention relates to metallurgy and can be used at electroslag steel making to obtain hollow cast ingots. Remelting is performed in a crystalliser with a cooled mandrel of consumable metal electrodes on basic and additional fluxes. With that, consumable rotating metal electrodes with axial holes are used, through which additional flux is supplied during remelting to a slag bath; continuous measurement of temperature of slag and metal in the crystalliser, concentration of oxygen and content of carbon in metal, position of a slag-metal boundary is performed by means of temperature control sensor and a sensor with an electrochemical element, and remelting of the above electrodes is performed so that optimum temperature of slag and metal melt is provided.
	Mixture for steel making in electroslag furnace with production of raw material for zinc industry Invention relates to electric furnace steelmaking, and namely to a composition of a mixture for steel making in an electric-arc furnace. The mixture contains the following components, wt %: dust of a gas cleaning system of an electric-arc furnace 60-90 and coke fines 10-40.
	Method for plate manufacture from textured electrical steel Manufacturing method of textured electrical plate steel involves manufacture of a steel slab, in which content of inhibitor components is reduced, i.e. content of Al of 100 ppm or less and content of N, S and Se of 50 ppm respectively, hot rolling of steel, and then, one cold rolling or two or more cold rolling operations with intermediate annealing operation(s) between them to obtain a steel plate of final thickness; annealing of the steel plate for primary recrystallisation and then annealing for secondary recrystallisation; besides, annealing for the primary recrystallisation includes heating of a steel plate to the temperature that is equal or higher than 700°C, at the heating rate of at least 150°C/s, cooling of the steel plate to the temperature of 700°C or lower, and then, heating of the steel plate to the exposure temperature at average heating rate of not more than 40°C/s in the next heating zone.
	Method of controlling nuclear reactor and nuclear reactor core Invention relates to control of nuclear reactors. The control method includes forming a moderator zone in a nuclear reactor core, placing fuel in the moderator zone and providing one or more housings, wherein the one housing or each of the housings has a cavity adjoining the fuel. The method also includes providing movement of a moderator between the moderator zone and the cavity of one or more housings in the lower part of the one or more housings and placing the moderator in the cavity of one or more housings in the upper part of the one or more housings.
	Method for isolation of magnet core slots in motor stators In method for isolation of magnet core slots in micromotor stators all surface of the magnet core, excluding slots, is covered by a sealed dielectric shell made of elastic aggressive-resistant material, the magnet core is placed to a container filled with electrophoretic compound, two electrodes are led to butt ends of the magnet core and positive potential is supplied to the magnet core from a direct-current source and negative potential is supplied to the electrodes and electrophoretic precipitation of film-forming material is made; thereafter the magnet core is removed from electrophoretic compound, freed from the sealed dielectric shell and the film precipitated to the slot surface is subjected to thermal treatment during 4-5 min at temperature of 380-390°C.
	Method of identification of direction towards radio beacon station, radio compass, double frequency range finder Group of the inventions relates to navigation systems. The direction towards radio beacon station is determined by means of radiation towards the beacon and re-radiation by it of electromagnetic energy back as follows. From two points of the radio compass (as is, see below), with the base distance L between the points, towards the radio beacon station two continuous signals with frequency modulation with unilateral saw-toothed linearly incremental law (LLFM signal) are radiated, with close frequencies f₁ and f₂ of LLFM signal and identical wit its modulation frequency Fm and frequency deviation dfm, which are: received on the beacon, amplified by power and re-radiated towards the radio compass, where they are multiplied with radiated LLFM signals and the following signals are selected: Fpi=2DiFmdfm/C-2Vif₁/C and Fpj=2DjFmdfm/C-2Vif₂/C, where Di and Dj - the distance between radiocompass antennas and the radio beacon station antenna moving at the velocity Vi, C - speed of light, and then, after multiplication of signals with the frequencies Fpi and Fpj, the difference signal is selected with the frequency f₃=Fpi-Fpj, the value of which, at coincidence of the line of radiocompass antennas arrangement with the direction towards beacon, or perpendicular restored from the middle of the line of arrangement of radiocompass antennas, with the direction towards the beacon, irrespective of distance between the radio compass and beacon, is certain and allows to be sure, that at detection in the radio compass of the signal with the frequency f₃, the direction towards beacon is identified. The radio compass contains the radio beacon station and double frequency range finder with two antennas set on the base distance L to each other, the difference frequency filter outputs of which, through the series connected and narrow-band pass filter, are connected to the circuit of alarm system enabling. And the radio beacon station contains antenna, bandpass filter and power amplifier.
	Catalyst component, applied for olefin polymerisation, method of obtaining thereof and catalyst containing thereof Described are: a method of obtaining solid disperse particles of a catalyst component, applied for olefin polymerisation, which contains magnesium, titanium, halogen and a donor of electrons as essential composite parts, a catalyst, containing the said catalyst component, and a method of polymerisation. The method of obtaining the catalyst component includes the following stages: (1) dissolution of a magnesium halogenide in a dissolving system with the formation of a homogenous solution and optional addition of compound C - the internal donor of electrons - into the said mixture before dissolution, in the course of dissolution or after dissolution; (2) combination of a titanium compound and a co-precipitating agent with the solution from stage (1) with the formation of a mixture; (3) slow heating of the mixture from stage (2) to a temperature from 60 to 110°C, with compound D - internal donor of electrons - being optionally added in the course of heating or after heating and after achievement of a specified temperature the mixture is mixed for 0.5 to 8 hours, after which mother liquor is removed by filtration and a residual solid substance is washed with an inert solvent to obtain a magnesium- and titanium-containing solid substance; and (4) the magnesium- and titanium-containing solid substance from stage (3) is one or several times processed with the titanium compound and an optional compound E - internal donor of electrons - in an inert solvent with further washing of a solid substance with an inert solvent to obtain the catalyst component. The co-precipitating agent represents a combination of a co-precipitating agent A and a co-precipitating agent B. The agent A is, at least, one diol ester, represented by general formula (I): , in which radicals from R₁ to R₆ and from R¹ to R²ⁿ are given in the invention formula. The agent B represents, at least, one organic silane, represented by general formula (II): $R_{a}^{I} R_{b}^{I I} S i {(O R^{I I I})}_{c}$ , in which R^I and R^II are given in the invention formula.
	Compositions from polyphenylsulphone and polytetrafluoroethylene and their application Invention relates to a mixture of polyphenylsulphone (PPSU) and polytetrafluoroethylene (PTFE) for manufacturing moulded products from a synthetic material, to a method of manufacturing the moulded products from the synthetic material and the application of the said mixture. The PPSU and PTFE mixture is characterised by the fact that the content of PTFE in the mixture constitutes from 1 to 15 wt %, and the content of PPSU in the mixture constitutes from 99 to 85 wt %. PPSU and PTFE are mixed with each other in an extruder at a temperature of 340°C. The obtained compound is granulated, granulate is extruded at a screw temperature from 370 to 390°C with obtaining the moulded products from the synthetic material. The obtained formed products from the synthetic material are applied as anti-wear tapes in pipelines for petroleum products.
	Substituted derivatives of 4-aminocyclohexane Invention relates to novel compounds of general formula (1), which possess an affinity to the µ-opiod receptor and the ORL1-receptor. The invention also relates to the application of the said compounds for obtaining medications, which can be used in treatment of fear, stress and associated with stress syndromes, depressions, epilepsy, Alzheimer's disease, senile dementia, general cognitive dysfunctions, learning and memory disorders (as nootropic), withdrawal syndromes, alcohol and/or drug abuse and/or abuse of medications and/or alcohol, narcotic and medication addiction, etc. In general formula (1) (1) Y₁, Y₁ ^', Y₂, Y₂ ^', Y₃, Y₃ ^', Y₄ and Y₄ ^' in each case stand for -H; Q stands for -R₀, -C(=O)-R₀, -C(=O)OR₀, -C(=O)NHR₀, -C(=O)N(R₀)₂ or-C(=NH)-R₀; R₀ in each case stands for -C_1-8-aliphate, -C_3-12-cycloaliphate, -aryl, -heteroaryl, -C_1-8-aliphate-C_3-12-cycloaliphate, -C_1-8-aliphate-aryl, -C_1-8-aliphate-heteroaryl, -C_3-8-cycloaliphate-C_1-8-aliphate, -C_3-8-cycloaliphate-aryl or -C_3-8-cycloaliphate-heteroaryl; R₁ and R₂ independently on each other stand for -C-_1-8-aliphate; R₃ stands for -C_1-8-aliphate, -aryl, -heteroaryl or -C_1-8-aliphate-C_3-12-cycloaliphate; n stands for 0; X stands for -NR_A-;R_A stands for -C_1-8-aliphate; R_B stands for -C_1-8-aliphate; on condition that R₁, R₂, R_A and R_B simultaneously do not stand for the non-substituted-C_1-8-aliphate.
	Oxidised lipid compounds and their application In formula (I) each of A₁, A₂ and A₃ is independently selected from the group, consisting of O and S, R₁ represents an alkyl chain with the length of 2-28 carbon atoms, R₂ is selected from the group, consisting of (3-carboxy)propyl and (20carboxy)ethyl, and R₃ is selected from the group, consisting of H, C_1-20acyl, phosphate, phosphocholine, phosphoethanolamine, phosphoethanolamine-N-glutaric acid and phosphoserine. The invention also relates to a pharmaceutical composition, containing the said compounds, and to the application of the compounds for manufacturing a medication, intended for treatment or prevention of diseases or disorders, associated with inflammation, or for the reduction of the level of cytokine, selected from the group, consisting of interleukin-12 and interleukin-23.
	Method of removing air from catalyst cooler and apparatus therefor Invention relates to catalyst regeneration and specifically to a catalyst regenerator. The disclosed regenerator comprises: a housing having an inlet opening for the catalyst and combustion gas, an outlet opening for the regenerated catalyst, an outlet opening for feeding the catalyst into the cooler and an outlet opening for effluent gas; a catalyst cooler, having an inlet opening for a hot catalyst, linked to the outlet opening of said regenerator housing, which serves to feed the catalyst into the cooler, a gas distributor, an air vent, an outlet opening for the cooled catalyst and a plurality of heat-exchange pipes therein for carrying the coolant; and an air pipe which links said air vent with said regenerator housing. The invention also relates to a method for catalyst regeneration in said regenerator.
	Porous membrane and method of its production Set of inventions relates to porous membrane, separator for electrochemical device including said porous membrane and said separator and to method of its production. porous membrane contains cellulose fibres wherein the latter are produced from the mix of over 50 wt % of initial material first cellulose fibres with surface area defined by staining with "congo red" dye and making 250 m²/g or more and 500 m²/g or less; and less than 50 wt % of second cellulose fibres with surface area defined by "congo red" staining and making 150 m²/g or more and less than 250 m²/g.
	Copper- and manganese-containing catalysts based on non-noble metals for oxidation of carbon monoxide and volatile organic compounds Invention relates to methods (versions) of oxidation of carbon monoxide (CO) and volatile organic compounds (VOC), as well as to a catalytic composition for the said processes. The methods include a stage of bringing tail gases of a method of obtaining purified terephthalic acid, containing water vapours and the said CO and VOC, in contact with a catalyst composition, containing a promoter based on a non-noble metal and a catalyst based on a non-noble metal, applied on an oxide carrier, which includes one or several materials, selected from aluminium oxide, silicon dioxide, zirconium dioxide, cerium dioxide and titanium dioxide. The said catalyst composition in fact does not contain platinum group metals, and the said VOC include one or several compounds, selected from methylacetate, methane, methylbromide, benzene, methanol, methylethylketone, butane and butene. The catalyst based on a non-noble metal is selected from the group, consisting of copper (Cu), iron (Fe), cobalt (Co), nickel (Ni) and chrome (Cr), and at least one promoter of the catalyst based on a non-noble metal is selected from the group, consisting of neodymium (Nd), barium (ba), cerium (Ce), lanthanum (La), praseodymium (Pr), magnesium (Mg), calcium (Ca), manganese (Mn), zinc (Zn), niobium (Nb), zirconium (Zr), molybdenum (Mo), tin (Sn), tantalum (Ta) and strontium (Sr).