Computer-optimized antigens with wide reactivity spectrum for influenza viruses of h5n1 and h1n1

FIELD: biotechnology.

SUBSTANCE: recombinant influenza hemagglutinin (HA) polypeptide to elicit an immune response to the H5N1 influenza virus containing the amino acid sequence from residues 2-568 of SEQ ID NO: 1 encoding its nucleic acid containing the proposed polypeptide fusion protein and virus-like particle (VLP) to elicit a response to the H5N1 influenza virus, an expression vector containing the nucleic acid, and an isolated cell containing it, a composition and method for eliciting an immune response to the H5N1 influenza virus, and a method for immunizing a subject are proposed. The proposed group of inventions can be used in medicine for immunization against the H5N1 influenza virus.

EFFECT: proposed protein, VLP, and compositions are capable of eliciting an immune response with a wide range of reactivity to the H5N1 influenza virus.

19 cl, 8 dwg, 5 ex

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: method for synthesis of a 1,5-bis-(4-tetradecyl-1,4-diazoniabicyclo[2.2.2]octan-1-yl)pentane tetrabromide (C47H100Br4N4) derivative includes dissolving 1-tetradecyl-4-aza-1-azoniabicyclo[2.2.2]octane bromide in methanol while heating to temperature of 55°C, while stirring, adding two portions 1,5-dibromomethane to the obtained solution until a reaction mixture is obtained, which is then stirred and cooled to temperature of 18-22°C, after which 20 ml acetonitrile is added to the obtained mixture, followed by separation of the precipitate from the mother solution, wherein the precipitate is filtered out and dried in a vacuum and the obtained mother solution is evaporated to obtain a viscous syrup-like residue to which 40 ml acetonitrile is added and stirred while boiling with a reflux condenser to obtain a suspension which is then cooled to temperature of 18-22°C and the precipitate formed is filtered out, dried in a vacuum and mixed with the previously obtained precipitate to obtain the end product.

EFFECT: wider range of antiviral agents for veterinary needs and obtaining a polycationic compound which enables to deal with a wide range of infectious diseases caused by RNA viruses.

7 cl, 1 dwg, 1 tbl, 3 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: group of inventions refers to viral vaccines for the dog protection against parvovirus infection, preparing and using them. More specifically, the invention refers to an attenuated recombinant parvovirus containing a DNA sequence of type 2 first attenuated parvovirus with the DNA coding a capsid protein of the first parvovirus is substituted by a capsid protein of type 2c parvovirus. The vaccine on the basis of the above virus is able to induce higher titres of the protective antibodies against a risk of type 2c parvovirus infection, preserving at the same time a good immunity against type 2 parvovirus. The strains of the recombinant virus also have been found to remain attenuated.

EFFECT: preparing viral vaccines for the dog protection against parvovirus infection.

6 cl, 4 dwg, 4 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: claimed invention relates to the field of biotechnology and virology. Described is a chimeric pestivirus, where the said chimeric pestivirus includes the cattle diarrhea virus, which does not express its homologous Erns protein. The said chimeric pestivirus expresses a heterologous Erns protein, originating from the other pestivirus, or a natural, synthetic or genetic version of the said heterologous Erns protein. Also described are methods and sets for treatment or prevention of propagation of the infection, caused by the cattle diarrhea virus, as well as methods for a differentiation between the vaccinated animals and the animals, infected with the virus of a wild type.

EFFECT: invention can be used as immunogenic compositions and vaccines in animal breeding.

13 cl, 4 tbl, 5 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes recombinant classical swine fever virus (1111) that contains deletion of at least one amino-acid in TAVSPTTLR domain of protein E2, which corresponds to positions 829-837 of parent polyprotein CSFV, as well as the corresponding vaccine, kDNA molecule, a protection method of an animal against CSFV and a differentiation method of CSFV-infected animals.

EFFECT: invention can be used for vaccination of animals against swine fever.

17 cl, 10 dwg, 2 tbl, 2 ex

FIELD: biotechnologies.

SUBSTANCE: nanocomposites made of nanoparticles of titanium dioxide in amorphous or crystalline (anatase, brookite) form, immobilised polylysine derivatives of oligonucleotides (PL-oligo) and photoactivated arylazide groups introduced in amino groups of polylysine. All components of the nanocomposite perform a certain function: TiO2-nanoparticles support transfection of cells; polylysine helps to immobilise oligonucleotide onto the surface of nanoparticles and adds functional groups (NH2), which make it possible to add additional reaction-capable groups; oligonucleotides of certain sequence forward the composite towards the target sections of the virus RNA; the photoactivated perfluoroarylazide group after irradiation with light may damage nucleic acids.

EFFECT: directed action at genetic material inside a cell and suppression of its further functioning.

9 cl, 3 dwg, 15 ex

FIELD: medicine.

SUBSTANCE: invention refers to molecular biology, genetic engineering and virology. What is presented is a method for producing a preparation containing the viral antigens, involving a) cell inoculation with an infectious in the fluid, b) reproduction of the above virus in the above cells, c) collection of the above reproduced virus, d) inactivation of the above collected virus, and e) treatment of the above inactivated virus with a detergent to produce the preparation containing the viral antigens.

EFFECT: method may be used in medicine and pharmacology to produce vaccines.

21 cl, 1 dwg, 2 tbl, 3 ex

FIELD: biotechnologies.

SUBSTANCE: method to determine virulent and pathogenic forms of flue viruses is based on collection of an initial sample of a tissue/physiological fluid from patients who are possibly sick with flu, extraction and treatment of RNA preparations from the initial sample, synthesis of cDNA on the RNA matrix, analysis of a nucleotide sequence of the produced cDNA with the purpose to identify the mutation status of specific positions of flu virus segments, and calculation of two scoring-factors, by the value of which they decide on extent of virulence and pathogenicity of a flu virus.

EFFECT: method may be used to determine virulent and pathogenic forms of flu virus.

5 tbl, 4 ex

FIELD: biotechnologies.

SUBSTANCE: method to produce a flu virus is proposed, according to which hens are injected with a vaccine against flu, eggs are collected from vaccinated hens, the process of embryogenesis is initiated, eggs with a developing embryo are infected, introducing a flu virus into an allantoic cavity, infected eggs with developing embryos are incubated under temperature and moisture, which provide for virus replication, and the allantoic liquid is collected, which contains a virus. Also application of the flu virus and eggs produced by this method is proposed.

EFFECT: method improvement.

26 cl, 9 tbl, 5 ex

FIELD: biotechnology.

SUBSTANCE: method of preparation of composition comprising (i) virus-like particles is described, and the said virus-like particles are virus-like particles of RNA-containing bacteriophage, and (ii) an oligonucleotide, and the said oligonucleotide is packaged in the said virus-like particles. Also a method of production of nucleotide composition comprising oligonucleotides used in the above mentioned methods is described. Also the nucleotide composition produced with the method of this invention and their application is described. The said composition preferably has a purity of at least 98%, most preferably at least 99%. The invention can be used in medicine.

EFFECT: increased purification.

25 cl, 6 dwg, 1 tbl, 14 ex

FIELD: medicine.

SUBSTANCE: what is presented is an influenza A virus propagation inhibitor; the inhibitor represents a complex of titanium dioxide nanoparticles and virus-specific deoxyribozyme. Deoxyribozyme is presented by an oligonucleotide of the following nucleotide sequence - 5'-GAAATAAGAGGCTAGCTACAACGACCTTCATTA.

EFFECT: invention may be used for influenza A virus propagation inhibition in infected eukaryotic cells.

3 cl, 6 dwg, 1 tbl, 6 ex

FIELD: medicine.

SUBSTANCE: invention relates to field of biochemistry, in particular to antibody or its antigen-binding fragment, which is specifically bind with human TNFα. Also disclosed are: separated molecule of nucleic acid, which codes said antibody, vector of expression, which contains said molecule of nucleic acid, and host cell, which contains said vector, for expression of said antibody. Disclosed are pharmaceutical composition for treatment of TNFα-mediated disease, which contains therapeutically effective quantity of said antibody, and method of treating TNFα-mediated disease with application of claimed composition.

EFFECT: invention makes it possible to effectively treat TNFα-mediated diseases.

16 cl, 9 dwg, 2 tbl, 2 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biochemistry, in particular to isolated version of serine protease, containing, at least, from five to eight amino acid substitutions in positions, selected from the group, consisting of positions12, 14, 15, 16, 24, 35, 36, 39, 49, 54, 61, 63, 64, 65, 67, 69, 75, 76, 78, 79, 81, 86, 92, 93, 99, 109, 112, 121, 123, 125, 127, 143, 159, 179, 181, 184, 189, where substituting amino acid is selected from the group, consisting of F, G, L, V, I, S, A, Y, K, W, M, P, N, Q, T, E, H, R, C, N and D, where said substitutions are made in positions, equivalent to positions in protease Cellulomonas 69 B4, as well as to molecule of nucleic acid, which codes it. Described are: expression vector, which contains said molecule of nucleic acid, as well as host-cell, containing it. Also disclosed are cleaning composition, animal food, composition for fabric of leather processing, which contain said version of serine protease, as well as cleaning method with application of said cleaning composition.

EFFECT: claimed invention has improved caseinolytic activity and/or thermal stability, and/or stability in LAS, and/or improved casein hydrolysis in comparison with protease, which does not have said number of substitutions.

63 cl, 7 dwg, 21 tbl, 21 ex

FIELD: medicine.

SUBSTANCE: claimed invention relates to the field of biotechnology. Claimed are versions of a humanised anti-CD79b antibody, each of which is characterised by the presence of a light and heavy chain and a set of 6 CDR with a determined amino acid sequence. An epitope of the antibody from 11 amino acids is determined by the Biacore method. Disclosed are: an immunoconjugate of the antibody with a medication or means for inhibiting cell growth, where the antibody is bound with means covalently, and versions of the composition, based on an effective quantity of the immunoconjugate or the antibody, used for inhibiting B-cell proliferation; as well as a method of determining CD79b in a sample with the application of the antibody. Described are: an antibody-coding polynucleotide, as well as an expression vector and an isolated cell, containing the vector for obtaining the antibody. Disclosed are versions of applying the antibody or immunoconjugate for obtaining the medication for inhibiting the growth of CD79b-expressing cells for the treatment of an individual, affected with cancer, for the treatment of proliferative disease or for inhibiting B-cell proliferation.

EFFECT: invention provides novel antibodies, which can find further application in the therapy of proliferative CD79b-associated diseases.

91 cl, 8 tbl, 9 ex, 20 dwg

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to the field of biotechnology, namely, to obtaining inhibitors of adhesion and/or aggregation of platelets, and can be used in medicine. A polypeptide, used as a component of a pharmaceutical composition and in sets for screening of the inhibitors of platelet adhesion or aggregation, is obtained in a recombinant way with the application of a matrix of the salivary gland cDNA of Anopheles stephensi.

EFFECT: invention makes it possible to obtain the polypeptide, possessing inhibiting activity with respect to platelet aggregation and/or inhibiting activity with respect to platelet adhesion.

10 cl, 4 dwg, 5 ex

FIELD: chemistry.

SUBSTANCE: invention relates to genetic engineering and biotechnology. Disclosed is a method of evaluating bioactivity of chemical compounds, where the first step includes transient transfection of cell line HEK 293 with plasmid vector pX-Y-neo (X is any eukaryote transcription factor, Y is a proteotypic peptide corresponding to said transcription factor), which contains a minimal human adenovirus type 5 promoter; a green fluorescent protein gene; a nucleotide sequence which codes the binding site of the transcription factor; a nucleotide sequence which codes the proteotypic peptide; a neomycin resistance gene; the second step includes determining the activity of the transcription factor via fluorescent analysis and chromatographic-mass spectrometer measurement of the content of the proteotypic peptide in the transfected cell culture in the presence of the test substance compared to a transfected intact cell culture.

EFFECT: invention provides fast and highly sensitive evaluation of bioactivity of chemical compounds.

2 dwg, 1 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to the field of biotechnology, namely to obtaining insulin analogues, and can be used in medicine as a medication for reducing the glucose level in a patient's blood. An insulin analogue contains a polypeptide B-chain, including halogenated phenylalanine in B24 position, which provides an increased stability in comparison with non-halogenated insulin or insulin analogue. Halogenated phenylalanine represents ortho-monofluorophenylalanine, ortho-monobromophenylalanine or ortho-monochlorophenylalanine.

EFFECT: halogenation-conditioned insulin stabilisation makes it possible to simplify the treatment of patients with diabetes mellitus in developing countries, where there is no access to refrigerating equipment.

11 cl, 8 dwg, 7 tbl

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology and fundamental virology. Method includes obtaining chimeric virus by inserting gene of protein of icosahedral low-copy phloem-restricted virus (ILCPRV) envelope into effective viral vector based on tobamovirus RNA. After that plant is infected with obtained chimeric virus for it to multiply and accumulate in plant tissues. Finally, separation of chimeric virus from plant tissues is performed. Also described are plasmid for claimed method realisation, chimeric virus preparation, obtained by method described above, method of obtaining anti-serum to natural PLRV isolates and its application. Invention can be used in field of agriculture.

EFFECT: claimed is method for obtaining preparative quantities of viral particles, imitating virions of potato leaf roll virus (PLRV).

10 cl, 12 dwg

FIELD: biotechnologies.

SUBSTANCE: invention offers recombinant plasmid DNA coding a chimeric antibody against human tumour necrosis factor-alpha (TNF-alpha) based on pOptiVECTM-TOPO® plasmid. Invention refers to eukaryotic cell line as a producer of antibody to TNF-alpha, method of cell line obtainment by transfection of plasmid DNA according to the invention, and method of chimeric antibody obtainment for TNF-alpha by cultivation of cell line according to the invention.

EFFECT: increased synthesis level for antibodies against TNF-alpha by producer cells.

12 cl, 8 dwg, 1 tbl, 3 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology, i.e. use of asparaginase and a method of foodstuff preparation on the basis of asparaginase. Asparaginase, which has an amino acid sequence at least 90% homologous to the amino acid sequence of <SEQ ID NO:2>, and which after an incubation period of 5 min. within the temperature range of 70°C to 100°C has a residual activity of 200 U/mg, may be used for preparing a foodstuff or a stimulant. The foodstuff preparation method involves the incubation of the foodstuff with the above mentioned asparaginase at the incubation temperature of at least 50°C. Where necessary, the foodstuffs shall be warmed up to a temperature by at least 10°C higher than the incubation temperature. Where necessary, asparaginase shall be separated from the foodstuffs or amidohydrolase shall be inactivated. If required, the separated asparaginase shall be reused.

EFFECT: invention enables the reduction of asparagine or acrylamide contents in the asparagine-containing foodstuffs.

15 cl, 5 dwg, 11 tbl, 4 ex

FIELD: medicine.

SUBSTANCE: invention refers to biotechnology and virology. What is presented is a method for producing viral-like influenza virus particles (IVP) in a plant or a part thereof. The method involves the expression of a new influenza virus protein HA in plants and purification thereof. The invention also aims at IVPs containing the influenza virus protein HA and herbal lipids. The invention also refers to nucleic acids coding an improved influenza virus HA, as well as to vectors. The IVPs can be used in developing the influenza vaccines or for the treatment of existing vaccines.

EFFECT: presented group of inventions can be used in medicine.

18 cl, 44 dwg, 1 ex

Up!