Laundry detergents and cleansing compositions containing polymers with carboxyl groups

FIELD: chemistry.

SUBSTANCE: laundry detergent or cleansing composition are described, containing a polymer with a carboxyl group which comprises: (i) a structural unit (a) which is derived from a monomer (A) based on the acrylic acid in an amount from about 60% to about 70% by mass, on the assumption of 100% by mass of all structural units which are derived from all monomers in the polymer with a carboxyl group. The structural unit (a) is represented by the formula (2): where R1 is a hydrogen atom, a metal atom, an ammonium group or an organic amine group; and (ii) a structural unit (b) which is derived from the monomer (B) containing a sulfonic acid group in an amount from about 30% to about 40% by mass, on the assumption of 100% by mass of all structural units which are derived from all monomers in the polymer with a carboxyl group. The structural unit (b) is represented by the formula (4): where R2 is a hydrogen atom or a methyl group; R3 is a CH2 group, a CH2CH2 group or a direct relation; R4 and R5independently represent a hydroxyl group or-SO3Z; where Z is a hydrogen atom, a metal atom, an ammonium group or an organic amine group; and where at least one of R4 and R5 represents-SO3Z A polymer with a carboxyl group has a weight-average molecular weight from about 23,000 to about 50,000. The present invention also covers methods for production and methods for application of the cleansing composition.

EFFECT: improved whiteness or prevention of the dirt redeposition.

33 cl, 1 dwg, 10 tbl, 5 ex

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: invention relates to a particle of a bleaching agent, which has a) core, which contains more than 70 wt % of sodium percarbonate, b) internal envelope, containing sodium sulphate in the form of thenardite or burkeite in an amount of at least 50 wt %, and c) internal envelope, containing a water-soluble binding agent and at least one bleaching activator, selected from capable of perhydrolysis N-acyl and O-acyl compounds. The invention also relates to a method of obtaining the particle and to a detergent.

EFFECT: particles of the bleaching agent are stable in storage, suitable for storing in bins and make it possible to transport them safely and to work with them even in a hot and wet climate.

17 cl, 15 ex, 3 tbl

FIELD: chemistry.

SUBSTANCE: invention relates to bleaching compositions in the form of sacks with several compartments. Described is a sack with several compartments, containing the first compartment and the second compartment, with the first compartment containing a solid composition, and the solid composition contains a source of an oxygen bleaching agent, a bleaching activator, a polycarboxylate polymer, representing a copolymer of maleic acid/acrylic acid, and the second compartment containing a liquid composition, and the liquid composition contains a low molecular solvent, with the sack material being made in the form of a water-soluble film.

EFFECT: improved stability over time.

17 cl, 2 tbl

FIELD: personal use articles.

SUBSTANCE: present invention relates to the field of laundry washing. Described is a method for washing a batch of white laundry in a washing machine, preferably - a professional one, where a batch of laundry is subjected to at least three washing stages: at the first stage a detergent is added; at the second one a bleacher is added, at the third one a whitening additive containing a bleacher absorbent is added. Additionally described is application of the bleacher absorbent in the process of washing.

EFFECT: stains removal, odour and whiteness improvement.

7 cl, 6 tbl, 3 ex

Container // 2511399

FIELD: packing industry.

SUBSTANCE: invention relates to containers. It describes a container including detergent composition, first water-permeable guard wall, and second guard wall containing additional bleaching catalyst and base material containing a polymer material, and the second guard wall is made in the form of a film of 0.10-1.0 mm thickness, where bleaching catalyst comprises 0.001% to 10.00% of the second guard wall, and base material containing a polymer material comprises the rest of composition, and the film is made by extrusion or casting/ solvent casting. Application of container is described as well.

EFFECT: reduced amount of bleaching activation agent without deterioration of bleaching quality, reduced damage to an object.

12 cl, 6 ex

FIELD: chemistry.

SUBSTANCE: multi-compartment pouch having a water-soluble film and having at least a first and a second compartment, wherein each compartment contains a composition, suitable for use in laundry, containing a surfactant, wherein the second compartment contains a whitening agent that exhibits a tinting efficiency of at least 5 and a wash removal value in the range 30% to 95%, wherein the compositions in the first and second compartments are liquid compositions and the whitening agent contains: at least one chromophore component containing thiophene dye and a thiazole dye, and at least one polymer component.

EFFECT: providing a method of adding highly efficient whitening agents to a liquid detergent, which enables to avoid undesirable side effects, prolonged service life of the substrate, neutralising yellowing of cellulose substrates.

8 cl, tbl

FIELD: chemistry.

SUBSTANCE: invention relates to a bleaching agent based on granular sodium percarbonate, coated with a stabilising coat. The stabilising coat contains sodium sulphate, sodium carbonate, sodium silicate and additionally a photocatalyst based on an aluminium complex of sulphonated tetrabenzotetraazoporphines and a water-soluble optical bleaching agent, in wt %: sodium sulphate - 50.0-99.5, sodium carbonate - 0.1-49.884, sodium silicate - 0.1-5.0, said photocatalyst - 0.01-5.0, optical bleaching agent - 0.005-5.0.

EFFECT: invention increases stability and bleaching power of sodium percarbonate.

2 cl, 7 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to a bleaching agent based on granular sodium percarbonate, coated with a stabilising coat. The stabilising coat contains sodium sulphate, sodium carbonate, sodium silicate and additionally a water-soluble optical bleaching agent, in wt %: sodium sulphate - 50-99.5, sodium carbonate - 0.1-49.88, sodium silicate - 0.1-5.0, optical bleaching agent - 0.01-5.0.

EFFECT: invention increases stability and bleaching power of sodium percarbonate.

2 cl, 7 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to a bleaching agent based on granular sodium percarbonate, coated with a stabilising coat. The stabilising coat contains sodium sulphate, sodium carbonate, sodium silicate and additionally a photocatalytic bleaching agent based on an aluminium complex of sulphonated tetrabenzotetraazaporphines, in wt %: sodium sulphate - 50-99.5, sodium carbonate - 0.1-49.88, sodium silicate - 0.1-5.0, said photocatalytic bleaching agent - 0.01-5.0.

EFFECT: invention increases stability and bleaching power of sodium percarbonate.

2 cl, 7 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to a bleaching system for household textile items containing at least one bleaching agent, where the bleaching system is selected from peroxybenzoic acid, peroxy-6-naphthoic acid, peroxylauric acid, peroxystearic acid, phthalimido peroxycaproic acid, 6-phthalimido peroxyhexanoic acid, nonylimido peroxyamber acid, nonylimido peroxyadipic acid, 1,12-diperoxydodecanoic acid, 1,9-diperoxyazelaic acid, diperoxyisophthalic acid and 2-decyldiperoxybutane-1,4-diacid and coated by a shell in form of a layer of a polymer with urethane and urea groups, where a prepolymer with terminal NCO groups is obtained from macrools, ionic or potentially ionic polyols and polyisocyanates used in excess, said prepolymer being subjected to reaction with compounds which contain at least two amine groups which are reactive towards isocyanate with ratio of NCO groups to NH groups less than or equal to 1:1, after which said polymer is obtained via neutralisation.

EFFECT: obtaining a novel bleaching system.

11 cl, 2 ex

FIELD: chemistry.

SUBSTANCE: invention relates to aqueous liquid compositions for bleaching, cleaning and disinfecting surfaces. The invention describes an aqueous liquid bleaching composition which contains hypochlorite, a quaternary ammonium salt of formula: R1R2R3R4N+X-, where R1 - C10-C20 alkyl; R2, R3 and R4 - C1-C3 alkyl; X is an inorganic anion, and a viscousifying system which contains an amine oxide as a surfactant and a fatty acid. Described also is a method of imparting prolonged antibacterial activity on a solid surface using the said composition and a container for preparing the said composition.

EFFECT: obtaining a composition which retains its activity and stability during storage for 4 weeks.

16 cl, 2 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to stable liquid compositions which provide good stain removal and colour maintenance. Described are liquid compositions which contain a cationic cellulose polymer and a cellulase enzyme, wherein the liquid compositions contain less than about 20 wt % of water and are encapsulated in a water-soluble or dispersible film.

EFFECT: improved fabric care.

16 cl, 3 tbl, 5 ex

FIELD: chemistry.

SUBSTANCE: invention relates to dispersive detergent composition, where composition contains surface-active substance and/or washing component, protease and protease inhibitor. Protease represents subtilisin or 10R protease, where protease is present in concentration 1E-09 - 2E-03 mol/kg of detergent, ratio of inhibitor to protease constitutes 0.1-1000 mol of inhibitor/mol of protease, and where protease inhibitor represents peptide aldehyde. Versions of peptide aldehydes are given in the formula of invention. Invention also relates to method of obtaining said detergent composition, to application of composition for washing soiled products and to method of removing egg pollution.

EFFECT: obtaining detergent composition with increased washing ability of protease.

19 cl, 4 ex

FIELD: chemistry.

SUBSTANCE: claimed invention relates to biochemistry and represents detergent composition, which includes version of subtilisin, which has amino acid sequence, given in SEQ ID NO 1, and, at least, one additional ingredient, selected from: i) bleaching substances, selected from percarbonates, persulphates and organic peracids, ii) aminocarboxylates, or iii) sulphonated polymers, or iv) organophosphoric acids or their salts and their mixtures. Invention also relates to method of removal or reduction of soiling of protein-like substances from surfaces which have such soiling, with application of claimed composition.

EFFECT: claimed composition demonstrates good results in removal of soiling of protein-like substances, even in compositions with alkaline pH values.

20 cl, 2 tbl, 2 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes a version of thermolysin, which has an improved efficiency in comparison to thermolysin of a wild type. The above version of thermolysin contains a replacement chosen from T006G, F063P, T006H, S065K, T006I, S065Y, T006K, Y075G, T006M, Y075M, T006N, Y075T, T006P, Q128H, T006Q, Q128I, T006R, Q128L, T006V, Q128M, T006W, Q128V, T006Y, Q128Y, V007F, Y151D, V007H, Y151E, V007K, Y151H, V007L, Y151K, V007M, Y151M, V007P, Y151N, V007Q, Y151Q, V007R, Y151R, V007T, Y151T, V007Y, Y151V, T049G, T049H, I156M, T049I, I156R, T049K, I156T, T049L, I156W, T049N, G196R, T049P, Q273I, T049Q, Q273P, T049W, Q273Y, A058I, T278K, A058P, T278M, A058R, T278P, F063I, N280K, F063L, N280R. Thermolysin is obtained by transformation of Bacillus sp. with an expression vector containing a polynucleotide sequence coding a version of thermolysin and by cultivation of a transformed host cell under conditions suitable for production of the above thermolysin. This ferment is used as a part of a cleaning composition for cleaning of surfaces or items.

EFFECT: obtaining a version of thermolysin with improved efficiency.

55 cl, 9 dwg, 3 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: present invention relates to a dispersed bleaching composition which contains the following, with respect to the total weight of the composition: a) from about 15% to about 80% oxygen-containing bleaching agent; b) from about 0.01% to about 20% surfactant; c) and from about 0.00005% to about 0.3% enzyme, where said enzyme: i. exhibits endo-beta-1,4-glucanase activity (E.C.3.2.1.4); and ii. exhibits more than approximately 80% maximum activity at pH 9.2 when measurements are taken at 40C; and iii. does not contain a class A carbohydrate-binding module (CBM), and were the weight ratio of available oxygen to the surfactant is more than approximately 0.45.

EFFECT: obtaining a dispersed bleaching composition based on oxygen-containing peroxide bleaching agents with unexpectedly improved cleaning action and bleaching characteristics, as well as high fabric safety.

14 cl, 3 ex, 1 tbl

FIELD: chemistry.

SUBSTANCE: group of inventions relates to biotechnology. Disclosed is a composition for producing a fragrant ester. The composition contains SGNH-acyltranferase, an alcohol substrate containing 2-10 carbon atoms, and an acyl donor which is an ester substrate containing an acyl chain consisting of 2-10 carbon atoms. The alcohol substrate and the acyl donor are selected such that they produce a fragrant ester. Also disclosed is a method of producing a fragrant ester, according to which SGNH-acyltransferase, the alcohol substrate and acyl donor are combined in acyltransferase reaction conditions. Also disclosed is a method for simultaneous production of a bleaching agent, which is a peracid, and a fragrant ester. To this end, the SGNH-acyltransferase, alcohol substrate, acyl donor and aqueous hydrogen peroxide solution are combined in acyltransferase reaction conditions. The disclosed composition is used in detergents for removing stains, which contain at least one triglyceride, and for reducing unpleasant smells.

EFFECT: said SGNH-acyltransferase catalyses transfer of the acyl group from the acyl donor to the alcohol substrate to form a fragrant ester in an aqueous medium.

19 cl, 18 dwg, 9 tbl, 14 ex

FIELD: chemistry.

SUBSTANCE: invention relates to peptide aldehydes with tyrosine as C-end residue, which are especially efficient for stabilization of subtilisin-type proteases in liquid detergents.

EFFECT: obtaining novel composition.

6 cl, 3 ex

FIELD: biotechnologies.

SUBSTANCE: described method consists in provision of a composition for washing of dishware and dishware to be cleaned, bringing of the above dishware into contact with the above dishware washing composition under conditions that contribute to effective cleaning of the above dishware, where the above dishware washing composition contains modified subtilisin, where the above modified subtilisin is at least by 70% homological to the following sequence: AQSVPWGISRVQAPAAHMIGLTGSGVKVAVLDTGISTHPDLN1RGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATS LGSTNLYGSGLVNAEAATR and contains (i) replacement G116V and at least one additional mutation; or (ii) replacement S126R.

EFFECT: invention allows removing protein contaminations from dishware with high efficiency and is safe for users and environment.

6 cl, 6 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes use of a composition containing transglycosidase ferment (EC 2.4.1.24) for decomposition of polysaccharide of natural gum. The above polysaccharide of natural gum is a substrate for the above ferment of transglycosidase. A natural gum destruction method is described, which involves contact of transglycosidase ferment with polysaccharide of natural gum for destruction of the above polysaccharide of natural gum. Besides, a cleaning method is proposed, which involves contact of an object contaminated with polysaccharide of natural gum with cleaning composition including transglycosidase ferment; and maintenance of the above object and cleaning composition under conditions sufficient for effective destruction of polysaccharide of natural gum, and thus, cleaning of the above object.

EFFECT: invention allows decomposing natural gums by means of transglycosidase ferment.

19 cl, 7 dwg, 4 ex

FIELD: biotechnologies.

SUBSTANCE: compositions containing active versions of alpha-amylase are proposed. Besides a new version of alpha-amylase, compositions as per the invention usually contain at least one additional ferment, a detergent, one surface-active substance, one complexing agent, an oxidiser, an acidifying agent, an alkaliser, a peroxide source, a harness source, salt, a detergent complexing agent, a polymer, a stabilising agent or a conditioner. Besides, application methods of those compositions for scouring of woven fabric, for washing or cleaning of products, such as dishware or linen, which are contaminated with starch-containing substances, are described.

EFFECT: improved thermal stability relative to parental; form of AmyS-like alpha-amylase, from which they have been obtained.

10 cl, 12 tbl, 24 dwg, 14 ex

FIELD: chemistry.

SUBSTANCE: invention relates to compositions for purification of solid surfaces, containing acidic component; one or more surfactants; surface-modifying polymer; component for control of unpleasant odour, which contains effective quantity of two or more volatile aldehydes, selected from 2-ethoxybenzylaldehyde, 2-isopropyl-5-methyl-2-hexenal, 5-methylfurfural, 5-methyl-thiophene-carboxaldehyde, adoxal, p-anisic aldehyde, benzylaldehyde, bourgeonal, cinnamic aldehyde, cymal, decyl aldehyde, floral super, florhydral, helional, lauryl aldehyde, ligustral, lyral, melonal, o-anisic aldehyde, linoacetaldehyde, P.T.Bucinal, thiophenecarboxaldehide, trans-4-decenal, trans trans 2,4-nonadienal, undecyl aldehyde; and water carrier ,with component for unpleasant odour control containing from 35% to 60% of volatile aldehydes with B.P. 250C or higher and ClogP 3.0 or higher; or 25% of aldehydes which have B.P. approximately 250C or lower and ClogP approximately 3 or lower; or 10% of aldehydes, which have B/P/ 250C or lower and ClogP 3.0 or higher; or from 10% to 30% of aldehydes, which have B.P. 250C or higher and ClogP 3.0 or lower.

EFFECT: invention provides neutralisation and concealing wide spectrum of unpleasant odours, including amine and sulphur unpleasant odours.

17 cl, 1 dwg, 10 tbl, 23 ex

Up!