Esters of pentamidine-amidoxime acids as prodrugs and their application as medicinal agents
FIELD: chemistry.
SUBSTANCE: invention relates to pentamidine prodrugs, namely to compound of formula given below, where n equals to 2, as well as to its pharmaceutically acceptable salts, solvates, salts of solvates, which have improved properties, such as solubility and bioavailability, compared to existing prodrugs.
EFFECT: invention also relates to method of producing said compound, various versions of therapeutic agents for treating and/or preventing diseases, selected from oncological and tumor diseases, leishmaniasis, trypanosomiasis, pneumocystis pneumonia and malaria, including this compound, and methods of treating above diseases.
13 cl, 7 dwg, 5 tbl
FIELD: organic chemistry, biochemistry, medicine, pharmacy.
SUBSTANCE: invention relates to new derivatives of phenylglycine of the formula (I) , to their hydrates or solvates, and/or to physiologically acceptable salts and/or physiologically acceptable esters possessing inhibitory effect on amidolytic activity of the complex factor VIIa/tissue factor that can be used for therapeutic and/or prophylactic treatment of diseases, for example, thrombosis. In the formula (I) R1 means (C1-C6)-alkyl; R2 means hydrogen atom, hydroxy-(C1-C6)-alkoxy-, (C1-C6)-alkoxycarbonyloxy-, (C1-C6)-alkoxy-group or halogen-(C1-C6)-alkoxycarbonyloxy-(C1-C6)-alkoxy-group; R3 means hydrogen atom, (C1-C6)-alkoxy- or heterocycloalkyloxy-group wherein heterocycloalkyl group means 5-6-membered ring comprising a heteroatom taken among nitrogen and oxygen atom; R4 means hydrogen atom or ester residue that is cleaved off under physiological conditions. R5 means hydrogen atom, hydroxy-group, (C1-C6)-alkoxycarbonyl, halogen-(C1-C6)-alkoxycarbonyl, (C6)-aryloxycarbonyl,(C6)-arylalkoxycarbonyl, (C1-C6)-alkoxy-(C1-C6)-alkoxy(C1-C6)-alkoxycarbonyl, (C3-C6)-cycloalkyloxycarbonyl, (C2-C6)-alkynyloxycarbonyl, 5-methyl-2-oxo[1,3]dioxol-4-yl-methoxycarbonyl, (C6)-arylcarbonyloxy-, (C1-C6)-alkylaminocarbonyloxy-group, (C1-C6)-alkylcarbonyl, arylcarbonyl, arylaminocarbonyl or heteroarylcarbonyl wherein heteroaryl represents 5-6-membered ring comprising nitrogen atom the cycle; X means atom F, Cl or Br. Also, invention relates to a method for preparing compounds, intermediates substances and pharmaceutical composition and a method for treatment.
EFFECT: improved preparing method, valuable medicinal properties of agents and composition.
29 cl, 5 ex
FIELD: chemistry.
SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.
EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.
27 cl, 8 dwg, 21 tbl, 11 ex
FIELD: medicine, pharmaceutics.
SUBSTANCE: invention refers to 2-(3-amino-1-(2,4-difluorophenyl)-1H-1,2,4-triazol-5-yl)-N-methyl-4,5-dihydrobenzo[b]thieno[2,3-d]oxepin-8-carboxamide. As well as to a pharmaceutical composition containing the above compound, to the use thereof and a set for treating.
EFFECT: 2-(3-amino-1-(2,4-difluorophenyl)-1H-1,2,4-triazol-5-yl)-N-methyl-4,5-dihydrobenzo[b]thieno[2,3-d]oxepin-8-carboxamide inhibiting PI3 kinase (PI3K).
6 cl, 15 dwg, 1 tbl, 610 ex
FIELD: medicine.
SUBSTANCE: claimed invention relates to the field of biotechnology. Claimed are versions of a humanised anti-CD79b antibody, each of which is characterised by the presence of a light and heavy chain and a set of 6 CDR with a determined amino acid sequence. An epitope of the antibody from 11 amino acids is determined by the Biacore method. Disclosed are: an immunoconjugate of the antibody with a medication or means for inhibiting cell growth, where the antibody is bound with means covalently, and versions of the composition, based on an effective quantity of the immunoconjugate or the antibody, used for inhibiting B-cell proliferation; as well as a method of determining CD79b in a sample with the application of the antibody. Described are: an antibody-coding polynucleotide, as well as an expression vector and an isolated cell, containing the vector for obtaining the antibody. Disclosed are versions of applying the antibody or immunoconjugate for obtaining the medication for inhibiting the growth of CD79b-expressing cells for the treatment of an individual, affected with cancer, for the treatment of proliferative disease or for inhibiting B-cell proliferation.
EFFECT: invention provides novel antibodies, which can find further application in the therapy of proliferative CD79b-associated diseases.
91 cl, 8 tbl, 9 ex, 20 dwg
FIELD: medicine.
SUBSTANCE: invention refers to biotechnology, virology and medicine. The method provides administering a pox virus containing the defect F2L gene into a host body or a cell. What is also described is using this pox virus for producing a drug preparation for treating proliferative diseases or diseases accompanied by osteoclast hyperactivity. The invention can be used in medicine.
EFFECT: what is presented is the method of treating proliferative diseases or diseases accompanied by osteoclast hyperactivity.
28 cl, 10 dwg, 3 tbl
FIELD: medicine, pharmaceutics.
SUBSTANCE: invention relates to methods of obtaining heteroaryl compounds, represented by structural formulae (I) or
(II): where R1-R4 have values, given in subcl. 1,14 of the formula.
EFFECT: compounds can be used for treatment or prevention of cancer, inflammatory states, immunological states, etc.
29 cl, 20 ex
FIELD: chemistry.
SUBSTANCE: invention relates to novel choline salt of 3-[2-fluoro-5-(2,3-difluoro-6-methoxybenzyloxy)-4-methoxyphenyl]-2,4-dioxo-1,2,3,4-tetrahydrothieno[3,4-d]pyrimidine-5-carboxylic acid, corresponding to formula and to its crystalline form. Crystalline form of salt (A) has characteristic peaks at diffraction angles (2θ(E)) 7.1, 11.5, 19.4, 20.3, 21.5, 22.0, 22.6, 23.5 and 26.2 in diagram of powder diffraction of X-rays, characteristic peaks of values of chemical shifts (δ(ppm)) 155.8, 149.8, 145.3, 118.0, 113.7, 111.6, 110.3, 98.1, 69.8, 58.7, 57.1 and 55.5 in solid-state 13C NMR spectrum and characteristic peaks of values of chemical shifts (δ(ppm)) -131.6, -145, and -151.8 in solid-state 19F NMR spectrum, as well as endothermic peak about 213°C in diagram of differential-thermal analysis.
EFFECT: compound has excellent solubility and stability in storage.
5 cl, 5 dwg, 3 tbl, 8 ex
FIELD: chemistry.
SUBSTANCE: invention relates to biotechnology, specifically to novel hetero-multimeric proteins obtained from modified ubiquitin, and can be used in medicine to treat or diagnose diseases associated with hyperprodution of the extradomain B of fibronectin (ED-B). The protein includes two monomeric ubiquitin links which are differently modified through substitutions of at least 6 amino acids in positions 4, 6, 8, 62, 63, 64, 65 and 66 of SEQ ID NO: 1. In the first monomer link the substitutions include: F4W, K6(H, W or F), Q62N, E64(K, R or H), S65(L, F or W), T66(S or P), and in the second monomer link: K6(T, N, S or Q), L8(Q, T, N or S), Q62(W or F), K63(S, T, N or Q), E64(N, S, T or Q), S65(F or W), T66(E or D).
EFFECT: invention enables to obtain a modified heterodimeric ubiquitin protein, capable of binding with ED-B with high affinity.
28 cl, 18 dwg, 3 tbl, 7 ex
FIELD: chemistry.
SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.
EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).
8 cl, 16 dwg, 1 tbl, 8 ex
FIELD: chemistry.
SUBSTANCE: invention relates to field of organic chemistry, namely to polymorphs of form 1 and form 2 of (-)trans-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolon-I-yl)-4-(1H-indol-3-yl)pyrrolidin-2,5-dione. Invention also relates to methods of obtaining said polymorphs and pharmaceutical composition on their basis.
EFFECT: novel polymorphs of (-)trans-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolon-I-yl)-4-(1H-indol-3-yl)pyrrolidin-2,5-dione are obtained, useful in cancer treatment.
23 cl, 26 dwg, 2 tbl, 27 ex
FIELD: medicine, pharmaceutics.
SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.
EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.
22 cl, 7 dwg, 2 tbl, 8 ex
FIELD: medicine, pharmaceutics.
SUBSTANCE: invention refers to compounds of the structural formula I
which can be used for treating and/or preventing malaria caused by Plasmodium falciparum. In formula I: X means CH or N, R1 means -NO2, -N(CH3)2 or -NCH3(CH2CH2OH) and R2 means hydrogen, methyl, ethyl, n-propyl, isopropyl, tert-butyl, cyanogroup, halogen, methoxygroup, ethoxygroup, n-propoxygroup, isopropoxygroup, trifluoromethyl, difluoromethoxygroup, methylsulphonyl, acetyl or acetylaminogroup; or X means CH, R1 means hydrogen and R2 means ethyl, isopropyl, tert-butyl, ethoxygroup, n-propoxygroup, isopropoxygroup, methylsulphonyl, acetylaminogroup or methoxycarbonyl; or X means CH, R1 means a cyanogroup and R2 means ethyl, isopropyl, tert-butyl, ethoxygroup, n-propoxygroup, isopropoxygroup, trifluoromethyl, difluoromethoxygroup, trifluoromethoxygroup, methylsulphonyl or acetylaminogroup; or X means CH, R1 means chlorine and R2 means ethyl, isopropyl, tert-butyl, ethoxygroup, n-propoxygroup, isopropoxygroup, difluoromethoxygroup, methylsulphonyl or acetylaminogroup; or X means CH, R1 means a methoxygroup or isopropoxygroup and R2 means trifluoromethyl; or X means CH, R1 means methylsulphonyl or ethylsulphonyl and R2 means trifluoromethyl, ethyl, isopropyl, tert-butyl, ethoxygroup, n-propoxygroup, isopropoxygroup or difluoromethoxygroup.
EFFECT: invention refers to a pharmaceutical composition containing the above compounds, and to using the compounds for preparing the pharmaceutical composition.
22 cl, 2 tbl, 73 ex
FIELD: medicine, pharmaceutics.
SUBSTANCE: invention relates to novel compounds of formula (I), possessing properties, making it possible to inhibit phosphorylation of AKT (proteinkinase B; PKB), to versions of method of their obtaining, as well as to intermediate products for their obtaining. In particular compounds can be applied in treatment of different tumours and/or metastases, as well as in case parasitic diseases such a malaria. In formula (I), R1 stands for -L-phenyl or -L-heteroaryl, with term "heteroaryl" standing for bicyclic radical, containing from 9 to 12 units, L stands for either linear or branched alkyl, containing 1-6 carbon atoms, optionally substituted with hydroxyl, or CO group, or group L'-X, where L' stands for linear or branched alkyl, containing 1-6 carbon atoms, and X stands for oxygen or sulphur atom; with phenyl and heteroaryl being optionally substituted with one or several radicals, similar or different, selected from halogen atoms, -NRxRy, alkoxy and alkyl; with said alkyl being optionally substituted with one or several halogen atoms; R2 stands for hydrogen atom or alkyl; R3 stands for alkyl, optionally substituted with one or several halogen atoms; R4 stands for hydrogen atom or halogen atom; with NRxRy being such that Rx and Ry form together with nitrogen atom, which they are bound to, cyclic radical, including 3-10 units, and optionally oxygen atom; and all alkyl or alkoxy radicals, mentioned above, are linear or branched and contain 1-6 carbon atoms.
EFFECT: compounds can be applied as active component for obtaining medications, intended for treatment or prevention of disease, characterised by deregulation of protein- or lipidkinase activity.
25 cl, 3 tbl, 43 ex
FIELD: medicine, pharmaceutics.
SUBSTANCE: invention refers to compounds of formulas I,
II,
III,
IV,
V,
VIII or to their pharmaceutically acceptable salts, wherein: Z represents
,
or phenyl; D represents
or
; X represents N(R9), O, S, S(=O) or S(O)2; each Y independently represents O or S; G represents
or
; the other radical values are described in the patent claim. The invention also refers to pharmaceutical compositions based on the above compounds.
EFFECT: there are prepared new compounds and based compositions which can find application for treating malaria or eliminating or inhibiting the growth of Plasmodium species.
30 cl, 3 tbl, 23 ex
FIELD: chemistry.
SUBSTANCE: disclosed is use of 2-(4,5-dichloroimidazolyl-1)-5-nitropyridine as an anti-protist agent. Anti-protist activity of 2-(4,5-dichloroimidazolyl-1)-5-nitropyridine is equal to 15.6 mcg/ml for Colpoda steinii. The substance can also relate to moderately toxic medicinal drugs.
EFFECT: high anti-protist activity.
1 tbl
FIELD: chemistry.
SUBSTANCE: invention relates to dispiro 1,2,4-trioxolanes of formula: , where values of R are given in claim 1.
EFFECT: disclosed compounds unexpectedly enable to treat malaria with a single dose and provide preventive action against malaria and bilharzia.
17 cl, 6 tbl, 5 ex