Therapeutic compositions

 

The invention relates to medicine and concerns the use of compounds selected from D--hydroxybutiric acid and/or its metabolic precursor, as an active agent, drug or food product for the treatment of diabetes, reversion, slowing or prevention of neurodegenerative disorders and epilepsy, new compounds and method for their synthesis. The invention improves the efficiency of the treatment. 5 C. and 16 h.p. f-crystals, 3 tables.

Description text in facsimile form (see graphic part)-

Claims

1. The use of compounds selected from D--hydroxybutiric acid and/or a metabolic precursor D--hydroxybutiric acids, including D--hydroxybutylidene residues, oligo - D--hydroxybutylidene the remains of the acid or poly - D--hydroxybutylidene residues, or a physiologically acceptable salt of any of them as the active agent, drug or food product (I) for the treatment of diabetes or insulin resistant Silesia.

2. Application under item 1, wherein the neurodegenerative disorder is a disorder associated with the presence of a neurotoxic protein plaques.

3. Application under item 1, wherein the metabolic precursor further includes the remains of (R)-1,3-butanediol or acetoacetyl.

4. Application under item 3, wherein the metabolic precursor is a complex ether.

5. Application under item 4, characterized in that the esters are esters of monatomic, diatomic and triatomic alcohols.

6. Application under item 1, characterized in that the esters are esters of acetoacetate.

7. Application under item 1, characterized in that the esters are esters of D--hydroxybutyrate or esters of oligomers or polymers D--hydroxybutyrate.

8. The use according to any one of p. 1-7, characterized in that the compounds are compounds of the formula

or their physiologically acceptable salts or esters, in each case, n is chosen so that the polymer or oligomer is easily metabolized in the organism of a human or animal to ensure polysto 1000.

10. Application under item 9, characterized in that n is an integer from 0 to 200.

11. Application under item 10, wherein n is an integer from 3 to 5.

12. Application under item 1, characterized in that the medicinal product ratio D--hydroxybutyrate and acetoacetate is from 1:1 to 20:1.

13. The connection formulas

or its pharmaceutically acceptable salts or esters, and n is chosen so that the polymer or oligomer is easily metabolized in the organism of a human or animal to provide an elevated level of ketone bodies in the blood.

14. Connection on p. 13, characterized in that the esters are esters of monatomic, diatomic and triatomic alcohols.

15. Connection on p. 14, wherein said complex ester is an ester of (R)-1,3-butanediol.

16. The method of synthesis of esters D--hydroxybutyryl-acetoacetate or poly - or oligo - D--hydroxybutyryl-acetoacetate, including the interaction of halide acetoacetic acid with D--hydroxybutyrate or poly - or oligo - D--hydrox the receiving halide acid.

18. The method of synthesis of esters D--hydroxybutyryl-acetoacetate, including interaction of D--halogenated with acetoacetic acid.

19. The method of synthesis of D--hydroxybutyryl-acetoacetate or oligo - D--hydroxybutyryl-acetoacetate, including interaction of D--hydroxybutiric acid with diketene.

20. The method according to p. 19, characterized in that the reaction is carried out in the presence of sodium acetate.

21. The method according to p. 20, characterized in that the reaction is performed in a nitrogen atmosphere.

 

Same patents:
The invention relates to flame retardants, substances that protect organic material from the ignition and combustion, in particular to intumestsent coke forming flame retardants, i.e

The invention relates to a method for producing 2-keto-L-gulonovoy acid, which is an intermediate for the synthesis of vitamin C, the oxidation of L-sorbose in the presence of platinum source of catalyst in aqueous-alkaline medium with equimolar content of NaHCO3at atmospheric pressure, intensive stirring and bubbling an oxidizing agent - pure oxygen - speed 440-460 ml/min

The invention relates to a method and apparatus for obtaining monocarboxylic acids from carbohydrates, derivatives of carbohydrates or primary alcohols

The invention relates to organic chemistry, in particular to methods for drugs

The invention relates to the field of organic chemistry, in particular for receiving calcium gluconate, which is used in medicine as a pharmaceutical drug
The invention relates to the treatment of non-insulin-dependent diabetes of adults (diabetes type II), in particular to the treatment of type II diabetes by the introduction of chromium picolinate and Biotin

The invention relates to medicine, in fairness to endocrinology, and for the treatment of diabetes and complications associated with diabetes

The invention relates to new derivatives of amine of the formula (I), where R1is karbamoilnuyu group (which may have one or two Deputydescribed later), thiocarbamoyl group (which may have one or two Deputydescribed later), sulfonyloxy group (which has one Deputydescribed next) or carbonyl group (which has one Deputydescribed below); R2represents a hydrogen atom; R3represents C1-C10alkyl group; W1, W2and W3each represents a single bond or C1-C8alkylenes group; X represents an oxygen atom or a sulfur atom; Y represents an oxygen atom; Q represents a sulfur atom; Z represents = CH-group or a nitrogen atom; Ar represents a benzene or naphthalene ring; L represents 1 to 2 substituents in Ar ring and each Deputy represents a hydrogen atom, a C1-C6alkyl group; Deputyrepresents (i) C1-C10alkyl group, (ii)3-Сu/chr/947.gif" ALIGN="ABSMIDDLE">described later), and so on; Deputyrepresents (i) C1-C6alkyl group, (ii) C1-C6halogenating group, (iii) C1-C6CNS group, (iv) halogen atom, (v) hydroxyl group, (vi) cyano, (vii) a nitro-group, (viii) alkylenedioxy; or its pharmaceutically acceptable salts or esters

The invention relates to medicine, in particular to diabetology, and for the treatment and prevention of diabetes type I and II, as well as conditions of hyperglycemia, hyperinsulinemia, decreased insulin sensitivity

The invention relates to medicine and applies to new analogues of fatty acids of General formula (1), pharmaceutical compositions for and methods of treating or preventing obesity, hypertension, fatty infiltration of the liver, multiple metabolic syndrome nutritional compositions and method of improving the quality of such products as meat, milk and eggs

-substituted derivatives of carboxylic acids" target="_blank">

The invention relates tosubstituted derivatives of carboxylic acids, characterized by the General formula (I), (II), (III) and (IV)

< / BR>
< / BR>
< / BR>
< / BR>
or their pharmacologically acceptable (C1-C6)-alkyl esters, or their pharmacologically acceptable Amida, or their pharmacologically acceptable salts
The invention relates to pharmaceutical compositions, in particular to pharmaceutical compositions comprising an inhibitor illegitimates (ARI) and angiotensin-converting enzyme (ACE), which is applicable for the prevention and treatment of complications of diabetes

The invention relates to new salts of pyridinium General formula (I) or their pharmaceutically acceptable salts, where R1is-R4- R5or-N(R7)N(R7R9, R4choose from the group of-N(R7R6O-, N(R7R6N(R7), -OR6O-,

-OR SIG6N(R7)-, where R6- alkyl, R5choose from the group of alkyl, aryl, including heteroaryl, -COR7, -SO2R7and-COR10where R7Is H, alkyl or aryl, including heteroaryl, R2Is F, Cl, Br, J, alkyl, aryl, including heteroaryl, formyl, acyl, C(O)NR7R10or C(O)or SIG7, m = 0, 1, or 2, R3selected from the group comprising R7OR7N(R7)(R10) and CH(R7)C(O)R8, R8is R7OR7and NR7R10, R9is hydrogen, alkyl, aryl, including heteroaryl, -C(O)R10, -SO2R10, -C(S)OTHER10, -C(NH)NH(R10), -C(O)OTHER10, R10- H, alkyl, or aryl, including heteroaryl, and in each case, it is not necessarily different from R7X represents an ion halogen provided that 1) when two alkyl groups are the same carbon or nitrogen, they are not necessarily linked together with the formation of a cyclic structure, and (2) nitrogen heteroaryl ring R1

The invention relates to a derivative of 3-aryl-2-hydroxypropionic acid, specifically to (S)-2-ethoxy-3-[4-(2-(4-methysulfonylmethane)ethoxy)phenyl] propionic acid having the formula I

Glp-1 derivatives // 2214419
The invention relates to a derivative of GLP-1 parent peptide having one or two lipophilic substituent attached optionally via an amino acid or dipeptide spacer to amino acid residue that is not N-terminal or C-terminal amino acid residue, where the parent peptide has the sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, or is in the amount of up to ten amino acid residues are replaced with any-amino acid residue which can be encoded using the genetic code

The invention relates to pharmaceutical industry and relates to a method of receiving anticonvulsant drug, which is a 3-benzylpyrrolidine-2,4-dione (1), namely, that the aminouksusnoy acid esters acelerou anhydrides of monoamino malonic acid in the presence of the solvent chloroform, the resulting product is converted into 3-alkoxycarbonylmethyl-2,4 in an alcohol solvent in the presence of ciclismo agent sodium alcoholate, the resulting product carbalkoxy by three times with boiling acetonitrile, at a concentration of product (V) 20-30 g/l in the reaction mixture, followed by cooling, filtration, distillation of acetonitrile, the resulting pyrrolidin-2,4-dione is administered in the reaction with the corresponding dialkylated of dimethylformamide or triakontameron, the resulting product is treated with benzylamine at 0-5oWith subsequent isolation of the target product

The invention relates to medicine, to use rihanana as anti-convulsants, excelling activity reference drugs and does not cause allergic reactions

The invention relates to new derivatives of benzothiadiazole, benzoxazoles and benzodiazines formula I in free base form or in the form of a pharmaceutically acceptable acid salt additive that can be used as an anxiolytic drug in the treatment of any condition, which is associated with increased endogenous levels of CRF or in which violated the regulation of the hPa system (hypothalamic - pituitary), or various diseases that are caused by CRF1or the manifestation of which contributes CRF1such as arthritis, asthma, allergies, anxiety, depression, etc

The invention relates to medicine and can be used to treat epilepsy

The invention relates to novel benzimidazole compounds represented by the General formula I

< / BR>
where denotes the number 0, 1, 2 or 3; R1represents an alkyl group, phenyl group or a monocyclic heterocyclic group containing as the heteroatom N or O, and these groups may be substituted once or more than once, by substituents selected from alkyl, cycloalkyl, cycloalkyl-alkyl, alkoxy, cyano, amino and nitro; or R1represents cyano or a group of formula-alkyl-CO2R2alkenyl-CO2R2, -CO-R2, -CO2(CH2)mR2or-C(R3)=N-OR2where m denotes the number 0, 1, 2 or 3; R2represents hydrogen, alkyl, phenyl, benzyl, 5 - or 6-membered heterocyclic group, which 5 - or 6-membered heterocyclic group may be substituted once or more than once by alkyl or alkoxy; or R2may represent a group of the formula -(CH2)q-NR4R5, -(CH2)q-CON(R4R5), -(CH2)q-CO2R4or-alkyl-CO2R4where R4and R5independently представляюUP> represents a group of General formula-CO2-R9where R9represents an alkyl or R9can represent a 6-membered heterocyclic group, and this 6-membered heterocyclic group may be substituted once or more than once by alkyl or alkoxy; or R9represents a group of General formula-alkyl-N(R10R12), where R10and R12independently represent hydrogen or alkyl; or R11represents a group of General formula II

< / BR>
where n denotes the number 0, 1, 2 or 3; R' and R" together with the N atom to which they are attached, form a heterocyclic ring with the number of members from 5 to 7, and this heterocyclic ring can contain as a ring member, one oxygen atom and/or one additional nitrogen atom; and in this formula, a heterocyclic ring with the number of members from 5 to 7, formed by R' and R", may be substituted once or more than once by a group of the formula -(CH2)px, where p denotes the number 0, 1, 2 or 3; X represents hydrogen, hydroxyl, alkyl or alkenyl, and these alkyl and alkenyl can be possibly substituted by one or more the>R6or-CON-R6R7where R6and R7independently represent hydrogen or alkyl; or R11may represent a group of General formula III

< / BR>
where n denotes the number 1; R' represents hydrogen or alkyl; R'" and R" 'together with the atoms to which they are attached, form a heterocyclic ring with the number of members from 5 to 7, and this heterocyclic ring can contain as a ring member one chain-CH=CH-; and in this formula, a heterocyclic ring with the number of members from 5 to 7, formed R'" and R"", may be substituted once or more than once by a group of the formula -(CH2)pX, where p denotes the number 0, 1, 2 or 3; X represents hydrogen, alkyl; or its pharmaceutically acceptable salt; provided that if R11is morpholinyl, R1may not represent tert-butyl; pharmaceutical compositions having the properties of the modulator of the GABAANDreceptors and the treatment of disorders and diseases of the living organism, and it is a disorder or disease responsive to modulation of GABAAND-receptor complex of the Central nervous

The invention relates to new pyrazole[3,4-d]pyrimidines having anticonvulsant and anti-allergic/asthma action methods for their preparation (options) and pharmaceutical compositions based on them
Up!