Regulatory/deployed peptides azrina

 

The invention relates to peptides having the amino acid sequence of at least 5 amino acids are identical to part ner receptor, corresponding to amino acids 308-373 this receptor, excluding the peptide TEKKRRETVEREKE. The connection according to the invention is able to induce a beneficial immune response in the body and can be used for cancer treatment. 30 C.p. f-crystals, 2 ill., table 1.

Description text in facsimile form (see graphic part).

Claims

1. A molecule is a peptide having an amino acid sequence identical to part of the ner receptor, corresponding to amino acids 308-373, excluding the peptide TEKKRRETVEREKE.

2. The peptide under item 1, at least 5 amino acids are identical to part ner receptor, corresponding to amino acids 333-373 this receptor, excluding the peptide TEKKRRETVEREKE.

3. The peptide under item 2, where a specified part ner-receptor corresponds to amino acids 333-355 this receptor.

4. The peptide under item 3 in length from five to thirteen amino acids.

5. The peptide under item 2, having the amino acid sequence MREKEELMLRLQDY (p) EEKTKKAERELSEQIQRALQ.

6. The peptide under item 2, having the amino acid sequence EREKE.

7. PEP is sledovatelnot KEEL.

9. The peptide under item 2, having the amino acid sequence KEELMLRLQDYEE.

10. The peptide under item 2, having the amino acid sequence KEELMLRLQDYpEE.

11. The peptide under item 2, having the amino acid sequence EELMLRLQDYEE.

12. The peptide under item 2, having the amino acid sequence EELMLRLQDYpEE.

13. The peptide under item 2, having the amino acid sequence ELMLRLQDYEE.

14. The peptide under item 2, having the amino acid sequence ELMLRLQDYpEE.

15. The peptide under item 2, having the amino acid sequence MLRLQ.

16. The peptide under item 2, having the amino acid sequence QDYEE.

17. The peptide under item 2, having the amino acid sequence QDYpEE.

18. The peptide under item 1, having the amino acid sequence AREEKHQKQLERQQLETEKKRRETVEREKEQM.

19. The peptide under item 1, having the amino acid sequence TEKKR.

20. The peptide under item 1, having the amino acid sequence TEKKRRETV.

21. The peptide under item 1, having the amino acid sequence TEKKRRETVER.

22. The peptide under item 1, having the amino acid sequence KKRRE.

23. The peptide under item 1, having the amino acid sequence KKRRETVE.

24. The peptide under item 1, having the amino acid sequence KKRRETVERE.

25. The peptide under item 1, having the amino acid consequently the third amino acid sequence KRRETVER.

28. The peptide under item 1, having the amino acid sequence KRRETVEREK.

29. The peptide under item 1, having the amino acid sequence KRRETVEREKE.

30. The peptide under item 1, having the amino acid sequence RRETV.

31. The peptide under item 1, having the amino acid sequence RETVEREKE.

 

Same patents:

The invention relates to a method of removing etiological (causal) factor (factors) vector-borne (transmitted) spongiform encephalopathies (TSE) of protein solutions, in particular from blood products, which will be used for therapeutic and other medical purposes

The invention relates to peptides consisting of 16-55 amino acid residues, the peptides comprise at least one of the amino acid sequence: FLCTHIIYS (SEQ ID NO:61), IIYSFANIS (SEQ ID NO: 62), FIKSVPPFL (SEQ ID NO:64), FDGLDLAWL (SEQ ID NO:65), LYPGRRDKQ (SEQ ID NO: 66), YDIAKISQH (SEQ ID NO:67), LDFISIMTY (SEQ ID NO:68), FISIMTYDF (SEQ ID NO: 69), FRGQEDASP (SEQ ID NO: 70), YAVGYMLRL (SEG ID NO:71), MLRLGAPAS (SEQ ID NO:72), LAYYEICDF (SEQ ID NO:73), LRGATVHRT (SEQ ID NO: 74), YLKDRQLAG (SEQ ID NO:75), LAGAMVWAL (SEQ ID NO:76), VWALDLDDF (SEQ ID NO: 77) or LDLDDFQGS (SEQ ID NO:78)

The invention relates to native proteins schemes complement modified such that the protein is able to form stable C3 to Mac

The invention relates to medicine, in particular to the use of autoantigen NS gp-39 and proteins containing amino acid sequence that detects at least 50% homology with the amino acid sequence of the NA gp-39, in particular with the amino acid sequence YKLVCYYT SWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (afterbirth

The invention relates to pharmacology, and in particular to means, inhibiting the transport of cationic amino acids, and reveals rabbit anticigarette induced against T-cell protein encoded by the genome of the IRU-2, and pharmaceutical composition comprising the specified anticigarette

The invention relates to genetic engineering and medicine, in particular to a new polypeptide

The invention relates to the field of medicine and biotechnology, namely to new proteins, which factors in the growth and development of megakaryocytes (MGDFs; mostly labeled Mp1-ligands), the biological activity of which is to stimulate the growth of megakaryocytes and their differentiation or maturation, which ultimately leads to the formation of platelets

Therapeutic protein // 2155810
The invention relates to a new protein - human stem cell factor (FGC, SCP), DNA sequences coding for this protein, its use in therapy, in particular for in vitro fertilization, as well as to pharmaceutical compositions containing such protein

The invention relates to medicine, namely to medicines

The invention relates to new thiazole derivatives of formula (I), where R1means (a), (b) or (C), R2means (II), R3denotes hydrogen, lower alkyl; R4denotes phenyl; R5-R8denote hydrogen; R9denotes hydrogen; R10denotes hydrogen, phenyl; And denotes oxygen, -CH=CH -, and t

The invention relates to medicine, namely to Oncology, and can be used to prevent the development of malignant tumors of the stomach

The invention relates to pharmaceuticals, to pharmaceutical compositions which possess improved antitumor effect or reduced(and) side(s) effect(s) consisting of the active substance having antitumor action, or a pharmaceutically acceptable salt thereof and a derivative of hydroxamic acids according to the formula or therapeutically applicable its acid salt additive

The invention relates to a new compound - peptide of General formula Thr-Gly-Glu-Asn-His-Arg, possessing the biological activity of inducing differentiation and inhibiting cell proliferation in tumors and activity of the tread and the normalizing action on the vital processes of mammalian cells obtained by the method of solid-phase peptide synthesis by sequential growth of the peptide chain and having the following properties: mol

The invention relates to new derivatives epothilone

< / BR>
where Q is selected from the group consisting of

< / BR>
< / BR>
where R8is hydrogen, alkyl;

< / BR>
where R11- alkyl, heterocycle; R12is hydrogen, W represents O or NR15where R15is hydrogen, Y and X represent O, Z1and Z2represent-CH2B1and IN2HE, R1-R7is hydrogen, alkyl; and their pharmaceutically acceptable salt, geometric, optical and stereoisomers, provided that compounds in which W and X both represent O; R1, R2and R7represent H; R3, R4, R6represent methyl; R8represents H or methyl; Z1and Z2represent CH2; G represents 1-methyl-3-(substituted-4-thiazolyl)ethynyl; Q is as defined above, is excluded, as well as to a method of treating cancer, diseases associated with hyperproliferating cells and method of achieving the patient antiangiogenesis effect
The invention relates to medicine and can be used in the treatment of multiple myeloma, mostly complicated radicular syndrome

The invention relates to veterinary

The invention relates to medicine, in particular to surgery, and can be used for sclerotherapy of large metastases in the liver

The invention relates to new chemical substances, specifically to arylsubstituted the oil - and anthraquinones of formula I:

< / BR>
where (a)-g) R=H; h) R=OMe; a) X=7-hydroxy-2-methyl-1,4 - naphthoquinone-5-yl; b) X= 7-hydroxy-2-methyl-6-etoxycarbonyl-1,4-naphthoquinone-5-yl; C) X=3-hydroxy-9,10-anthraquinone-1-yl; g) X= 8-hydroxy-3-trimethyl-siloxy-2-etoxycarbonyl-and 1,1, 4,4-Tetra-hydro-9,10-anthraquinone-1-yl; d) X=8-hydroxy-3-oxo-1,2,3,4-tetrahydro-9,10-anthraquinone-1-yl; (e) X=3-hydroxy-2-taxicab-Nile-4,4-dihydro-9,10-anthraquinone-1-yl; g) X= 3,8-dihydroxy-2-etoxycarbonyl-4,4-dihydro-9,10-anthraquinone-1-yl; C) X= 3-hydroxy-2-etoxycarbonyl-4,4-dihydro-9,10-anthraquinone-1-yl, possessing anti-HIV activity
Up!