Analogues of complement factor b and their application


FIELD: biotechnology.

SUBSTANCE: invention can be used in medicine to treat a disease mediated by activation of an alternative complement pathway. A polypeptide consisting of hfB3-292S (amino acids 1-764 or 26-764 in SEQ ID NO: 2), hfB3-292SN480 (amino acids 1-480 or 26-480 in SEQ ID NO: 2) or hfB3-292S-Fc (amino acids 1-990 or 26-990 in SEQ ID NO: 22) is obtained.

EFFECT: invention allows to effectively inhibit the activity of the alternative complement pathway when using the resulting polypeptide, coding its nucleic acid or expression vector.

12 cl, 14 dwg, 6 tbl, 19 ex

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: invention relates to biochemistry, particularly to an isolated nucleic acid molecule which codes a polypeptide, having delta-9-elongase activity, as well as a purified polypeptide having delta-9-elongase activity, which codes said isolated nucleic acid molecule. The invention also discloses an expression vector containing said isolated nucleic acid molecule, as well as a host cell, a transgenic plant and a transgenic seed containing same.

EFFECT: invention provides efficient production of polyunsaturated fatty acid-enriched oils.

18 cl, 9 dwg, 9 tbl, 6 ex

FIELD: biotechnology.

SUBSTANCE: method comprises production of enzyme preparations by submerged cultivation of microorganisms of enzyme preparations with continuous aeration with sterile air and mechanical agitation throughout the volume of the fermenter; receiving the hot air in the condenser of the heat pump with discharge of one its part to the spray drier, and the other - for heating water; returning the exhaust air after the recuperative heat exchanger and evaporator of the heat pump to the condenser to form recirculation loop; alternate supplying the obtained culture fluid under pressure for filtration to two filters mounted in parallel with the countercurrent aqueous regeneration of the filter element, that alternately operate in the mode of separation with the discharge of the precipitate and regeneration; discharge of culture fluid filtrate with the content of solids of 5-8% first in the storage collector and then to the spray drier using a vapour-compression heat pump; draining the condensate from the evaporator, followed by feeding under pressure to the filter operating in the regeneration mode.

EFFECT: invention enables to improve the quality and properties of the encapsulated enzyme preparations, to increase the shelf life of encapsulated enzyme preparations, as well as to improve energy efficiency.

1 dwg, 2 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology and specifically to a fermentation medium and a method of producing recombinant proteins using said medium. A fermentation medium for producing recombinant proteins selected from a group including GM-CSF, streptokinase and lipase, using microorganisms selected from a group including: E. Coli, Streptomyces sp. and Rhizomucor sp., is characterised by keeping concentration of urea or derivatives thereof in the range of 0.5 g/l to 2 g/l. The medium contains, per litre of water, basic salts in the following amounts: orthophosphoric acid (85%) 2.67-133.5 ml, calcium sulphate 0.093-4.65 g, potassium sulphate 1.82-91 g, magnesium sulphate-7H2O 1.49-74.5 g, potassium hydroxide 0.413-20.65 g, glycerine 4-200 g. The medium contains, per litre of water, trace elements in the following amounts: copper sulphate-5H2O 0.6-30 g, sodium iodide 0.008-0.4 g, manganese sulphate-H2O 0.3-15 g, sodium molybdate-H2O 0.02-1 g, boric acid 0.002-0.1 g, cobalt chloride 0.05-2.5 g, zinc chloride 2-100 g, iron (II) sulphate-7H2O 6.5-325 g, biotin 0.02-1 g, sulphuric acid 0.5-25 ml.

EFFECT: invention increases the output of end products.

6 cl, 27 dwg, 3 tbl, 16 ex

FIELD: chemistry.

SUBSTANCE: invention refers to biotechnology. What is presented is nucleic acid coding protein possessing acetyl-CoA-carboxylase activity making up the deficiency of acetyl-CoA-carboxylase in yeast, wherein a nucleotide sequence is specified in nucleic acid, which contains a nucleotide sequence: (a) coding protein consisting of the amino acid sequence SEQ ID NO:2; (b) hybridised in the hard conditions with nucleic acid complementary to SEQ ID NO:1; (c) SEQ ID NO:1; and (d) hybridised in the hard conditions with nucleic acid consisting of the complementary nucleic sequence coding protein SEQ ID NO:2; wherein SEQ ID NO:1 and 2 are disclosed in the description. There are also described: acetyl-CoA-carboxylase (SEQ ID NO:2) increasing the host-specific arachidonic acid content; a recombinant vector containing the above nucleic acid; and a cell transformed by the above vector for producing the fatty acid composition rich in arachidonic acid. What is presented is a method for producing the fatty acid composition involving culturing the above cell and collecting the fatty acid composition from the transformed cell culture.

EFFECT: invention enables producing the fatty acid composition rich in arachidonic acid in the host cell.

11 cl, 8 dwg, 5 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology, in particular to the microbiological industry, and represents a method of obtaining complex multienzymatic medications with cellobiohydrolase, endoglucanase, β-glucosidase (cellobiase) activities by the cultivation of recombinant strains of mycelium fungi of the Penicillium verruculosum family, transformed by linear fusion-construction, which represents successively connected through a linker homological genes and a heterologous gene of carbohydrases, such as cellobiohydrolase I, endogluconase and beta-glucosidase.

EFFECT: invention makes it possible to obtain effective the multienzymatic medication of a specified composition.

3 cl, 2 tbl, 3 dwg

FIELD: chemistry.

SUBSTANCE: group of inventions relates to biotechnology, in particular to peptydoglycane hydrolase biosynthesis, and represents a protein with the peptydoglycane hydrolase activity, a plasmid, containing a peptydoglycane hydrolase-coding fragment, a bacterium-producer, a method of microbiological peptydoglycane hydrolase synthesis, as well as a pharmaceutical composition, containing the obtained peptydoglycane hydrolase, for the therapy of diseases, caused by Gram-negative microflora.

EFFECT: elaborated method of microbiological synthesis makes it possible to obtain bacteriophage S-394 peptydoglycane hydrolase in an effective way.

22 cl, 2 dwg, 9 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology and a vector, a host cell containing a vector, a genetically modified microorganism Clostridium thermocellum, a method of producing said microorganism and a method of converting lignocellulose biomass to ethanol. The present vector is designed for acetate kinase gene knockout in Clostridium thermocellum and has nucleotide sequence SEQ ID NO:1 or SEQ ID NO:2. The present genetically modified microorganism is transformed by the nucleotide sequence SEQ ID NO:1 or SEQ ID NO:2, and can also further contain a non-native gene which provides the capacity to metabolise pentose sugar, hydrolyse xylan or is involved in metabolic production of ethanol. The present method of converting lignocellulose biomass to ethanol includes bringing the biomass into contact with said genetically modified microorganism.

EFFECT: invention enables to obtain a larger amount of ethanol.

17 cl, 53 dwg, 6 tbl, 10 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biochemistry and represents method of obtaining lysoglycolipid, including processing glycolipid-containing substrate wit, at least, one lipolytic enzyme to obtain said lysoglycolipid, where said lipolytic enzyme possesses glycolipase activity and where said lipolytic enzyme is obtained from genus Thermobifida, where lipolytic enzyme contains any amino acid sequence SEQ ID NO:5, 7 or 16 or amino acid sequence, which is for, at least, 70% identical to them, or is coded by any nucleotide sequence SEQ ID NO:6 or 17 or nucleotide sequence, which is for, at least 70% identical to them. Said lipolytic enzyme is also used for obtaining lysophospholipid, refining vegetable or food oil, conversion of polar lipids, as well as for obtaining food product.

EFFECT: invention makes it possible to extend arsenal of lipolytic enzymes.

28 cl, 17 dwg, 4 tbl, 12 ex

FIELD: biotechnology.

SUBSTANCE: invention relates to the field of biotechnology, in particular to the use of beta-galactosidase AsBgl_1390 from archaea Acidilobus saccharovorans as beta-glucosidase, beta-xylosidase and beta-mannosidase.

EFFECT: invention enables to expand the range of enzymes for use in biotechnological processes of conversion of lignocellulosic and other plant material into simple sugars, processes of lactose hydrolysis.

3 dwg, 2 tbl, 5 ex

FIELD: biotechnology.

SUBSTANCE: invention is a method of determining in an athlete of state of fatigue and a state of "overtraining" on increased gene expression of tryptophanyl-total RNA synthetase (TRSase). The method comprises taking a control sample from the athlete prior to intense training and the test sample after an intense training. As the sample the sample of blood or scraping or flushing with the oral cavity is used. The obtained cells are selected and washed. Total RNA is isolated from the cells. Reverse transcription is carried out and then amplifying of the cDNA obtained. The gene expression in TRSase is assessed in test and the control samples. Fatigue state and the state of "overtraining" is determined in case of a significant increase in gene expression level of TRSase in the test sample compared with a control sample, namely more than 1.45 times.

EFFECT: invention enables to increase significantly informational content, to simplify and accelerate the procedure of testing.

4 cl, 1 tbl, 3 dwg

FIELD: medicine.

SUBSTANCE: claimed invention relates to the field of biotechnology. Claimed are versions of a humanised anti-CD79b antibody, each of which is characterised by the presence of a light and heavy chain and a set of 6 CDR with a determined amino acid sequence. An epitope of the antibody from 11 amino acids is determined by the Biacore method. Disclosed are: an immunoconjugate of the antibody with a medication or means for inhibiting cell growth, where the antibody is bound with means covalently, and versions of the composition, based on an effective quantity of the immunoconjugate or the antibody, used for inhibiting B-cell proliferation; as well as a method of determining CD79b in a sample with the application of the antibody. Described are: an antibody-coding polynucleotide, as well as an expression vector and an isolated cell, containing the vector for obtaining the antibody. Disclosed are versions of applying the antibody or immunoconjugate for obtaining the medication for inhibiting the growth of CD79b-expressing cells for the treatment of an individual, affected with cancer, for the treatment of proliferative disease or for inhibiting B-cell proliferation.

EFFECT: invention provides novel antibodies, which can find further application in the therapy of proliferative CD79b-associated diseases.

91 cl, 8 tbl, 9 ex, 20 dwg

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology, specifically to novel hetero-multimeric proteins obtained from modified ubiquitin, and can be used in medicine to treat or diagnose diseases associated with hyperprodution of the extradomain B of fibronectin (ED-B). The protein includes two monomeric ubiquitin links which are differently modified through substitutions of at least 6 amino acids in positions 4, 6, 8, 62, 63, 64, 65 and 66 of SEQ ID NO: 1. In the first monomer link the substitutions include: F4W, K6(H, W or F), Q62N, E64(K, R or H), S65(L, F or W), T66(S or P), and in the second monomer link: K6(T, N, S or Q), L8(Q, T, N or S), Q62(W or F), K63(S, T, N or Q), E64(N, S, T or Q), S65(F or W), T66(E or D).

EFFECT: invention enables to obtain a modified heterodimeric ubiquitin protein, capable of binding with ED-B with high affinity.

28 cl, 18 dwg, 3 tbl, 7 ex

FIELD: biotechnologies.

SUBSTANCE: strain of cells of the Chinese hamster ovaries CHO-Inflix 20/5 is produced, transfected by vectors, expressing light and heavy chains of chimeric antibody against tumour necrosis factor alpha (TNF-α) of human being is produced. The strain is deposited into the Russian collection of cellular cultures under No. RKKK(P)760D.

EFFECT: invention allows to produce chimeric antibody with the specific efficiency no less than 33,5 picograms per cell a day.

4 dwg, 2 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: biotechnologies.

SUBSTANCE: invention offers recombinant plasmid DNA coding a chimeric antibody against human tumour necrosis factor-alpha (TNF-alpha) based on pOptiVECTM-TOPO® plasmid. Invention refers to eukaryotic cell line as a producer of antibody to TNF-alpha, method of cell line obtainment by transfection of plasmid DNA according to the invention, and method of chimeric antibody obtainment for TNF-alpha by cultivation of cell line according to the invention.

EFFECT: increased synthesis level for antibodies against TNF-alpha by producer cells.

12 cl, 8 dwg, 1 tbl, 3 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to biotechnology and immunology. Described are various variants of anti-IL-1R1 antibodies. The disclosed antibodies can be applicable for treating IL-1R1-mediated disorders, including rheumatoid arthritis, asthma, and chronic obstructive pulmonary disease (COPD).

EFFECT: presented group of inventions can be used in medicine.

21 cl, 14 dwg, 12 tbl, 5 ex

FIELD: chemistry.

SUBSTANCE: invention relates to the field of biotechnology and can be used for the identification of heteromultimeric ubiquitins possessing an ability to bind with a ligand-antigen. The method includes the contact of a totality of heterodimeric modified ubiquitins, including two ubiquitin monomers, bound to each other by a head-to-tail scheme, with the potential ligand in a display way. Each of the said monomers is modified in a different way and contains 5-8 substitutions in positions 2, 4, 6, 8, 62, 63, 64, 65, 66 and 68 SEQ ID NO:1. After that, a heterodimeric modified protein, which has bound with the ligand with the binding affinity Kd in the range of 10-7-10-12 M and the monovalent binding activity. Claimed are DNA-libraries, responsible for obtaining a population of the said heteromultimeric ubiquitins, as well as libraries of proteins, obtained by the expression of the said DNA-libraries.

EFFECT: invention makes it possible to obtain the novel bonding proteins based on heteromultimeric ubiquitin, capable of specific high affinity binding with the selected ligands.

8 cl, 17 dwg, 4 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: presented invention refers to immunology. There are presented versions of antibodies neutralising a subtype group 1 and subtype group 2 influenza A virus infection. The antibody is characterised by: either a set of 3 CDR of a light and 3 CDR of a heavy chain, or the presence of variable regions of the light and heavy chains. There are disclosed: a nucleic acid molecule coding the antibody; a cell expressing the antibody; as well as a method for the attenuation of the influenza A virus infection or reducing a risk thereof with the use of the antibody in a therapeutically or preventatively effective amount.

EFFECT: using the invention provides the antibodies neutralising the influenza A virus, which can find application in medicine in treating subtypes H1, H2, H3, H5, H7, H9 influenza.

18 cl, 6 tbl, 2 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: inventions deal with infectious molecule of nucleic acid, coding infectious porcine Torque teNO viruses (PTTV), which contains at least one copy of genome sequence, selected from the group, consisting of sequences, corresponding to genotypes or subtypesPTTV1a-VA, PTTV1b-VA, PTTV2b-VA and PTTV2c-VA, as well as to biologically functional plasmid or viral vector, containing such infectious nucleic genome sequence, and host-cell, containing such plasmid or vector. In addition claimed inventions include live, attenuated expressible with vector application and purified recombinant capsid subunit or killed viral vaccines for protection against PTTV infection, as well as methods of immunisation of pigs against PTTV viral infection by said vaccine introduction.

EFFECT: characterised inventions can be used to prevent infection, caused by porcine Torque teNo virus.

23 cl, 53 dwg, 5 tbl, 24 ex

FIELD: medicine.

SUBSTANCE: invention relates to the field of biotechnology, in particular to the lentiviral delivery of apoptin into tumour cells, and can be used in medicine. The method includes obtaining a lentiviral construct, expressing modified apoptin, fused with a sectretory signal of lactotransferrin and a transduction signal (ST-CTP-apoptin), with the further obtaining of recombinant lentiviral particles, defective by replication and carrying the modified apoptin, which are later introduced into T-lymphocytes (TILs), obtained in the surgical ablation of the tumour or in the process of obtaining a biopsy, possessing the ability to penetrate into tumour cells. After that, obtained TILs are autotransplanted to the said patient.

EFFECT: invention makes it possible to increase the ability of apoptin to penetrate into tumour cells and produce an oncolytic effect with respect to all the tumour cells.

2 dwg, 3 ex

FIELD: medicine.

SUBSTANCE: invention relates to field of biochemistry, in particular to antibody or its antigen-binding fragment, which is specifically bind with human TNFα. Also disclosed are: separated molecule of nucleic acid, which codes said antibody, vector of expression, which contains said molecule of nucleic acid, and host cell, which contains said vector, for expression of said antibody. Disclosed are pharmaceutical composition for treatment of TNFα-mediated disease, which contains therapeutically effective quantity of said antibody, and method of treating TNFα-mediated disease with application of claimed composition.

EFFECT: invention makes it possible to effectively treat TNFα-mediated diseases.

16 cl, 9 dwg, 2 tbl, 2 ex

Up!