Liposomes containing oligopeptide fragments of myelin basic protein, pharmaceutical composition and method for multiple sclerosis treatment

FIELD: biotechnology.

SUBSTANCE: invention relates to the production of liposomes with a peptide of the myelin basic protein (MBP), and can be used in medicine for multiple sclerosis treatment. A composition is prepared containing the MBP peptide with SEQ ID NO: 11 or SEQ ID NO: 12 bound to the first vector, wherein the vector comprises a liposome having a surface exposed to the target portion that contains a mannose residue or a mannose derivative.

EFFECT: invention provides greater therapeutic benefit than copaxone, therapeutically approved for the treatment of relapsing-remitting multiple sclerosis.

18 cl, 14 dwg, 14 tbl, 14 ex

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology, specifically to novel hetero-multimeric proteins obtained from modified ubiquitin, and can be used in medicine to treat or diagnose diseases associated with hyperprodution of the extradomain B of fibronectin (ED-B). The protein includes two monomeric ubiquitin links which are differently modified through substitutions of at least 6 amino acids in positions 4, 6, 8, 62, 63, 64, 65 and 66 of SEQ ID NO: 1. In the first monomer link the substitutions include: F4W, K6(H, W or F), Q62N, E64(K, R or H), S65(L, F or W), T66(S or P), and in the second monomer link: K6(T, N, S or Q), L8(Q, T, N or S), Q62(W or F), K63(S, T, N or Q), E64(N, S, T or Q), S65(F or W), T66(E or D).

EFFECT: invention enables to obtain a modified heterodimeric ubiquitin protein, capable of binding with ED-B with high affinity.

28 cl, 18 dwg, 3 tbl, 7 ex

FIELD: chemistry.

SUBSTANCE: invention relates to the field of biotechnology and can be used for the identification of heteromultimeric ubiquitins possessing an ability to bind with a ligand-antigen. The method includes the contact of a totality of heterodimeric modified ubiquitins, including two ubiquitin monomers, bound to each other by a head-to-tail scheme, with the potential ligand in a display way. Each of the said monomers is modified in a different way and contains 5-8 substitutions in positions 2, 4, 6, 8, 62, 63, 64, 65, 66 and 68 SEQ ID NO:1. After that, a heterodimeric modified protein, which has bound with the ligand with the binding affinity Kd in the range of 10-7-10-12 M and the monovalent binding activity. Claimed are DNA-libraries, responsible for obtaining a population of the said heteromultimeric ubiquitins, as well as libraries of proteins, obtained by the expression of the said DNA-libraries.

EFFECT: invention makes it possible to obtain the novel bonding proteins based on heteromultimeric ubiquitin, capable of specific high affinity binding with the selected ligands.

8 cl, 17 dwg, 4 ex

FIELD: chemistry.

SUBSTANCE: group of inventions refers to biotechnology. What is presented is a precursor protein for the recombinant preparation of peptides having a length of a sequence of 5 to 70 amino acid residues. The above protein contains a splittable recurrent sequence of target peptide elements (Pep) and auxiliary peptide elements (Aux) of general formula: (Pep-Aux)x or (Aux-Pep)x, wherein x>1. The elements Aux contain a self-assembled peptide element (SA). The elements Pep contain an amino acid sequence having a length of the sequence of 5 to 70 amino acid residues; ends of the elements comprise splittable sequences, which enable releasing the elements Pep from the precursor protein by specific splitting. There are also presented a nucleic acid molecule with a nucleic acid sequence coding the above precursor protein, an expression cartridge and a recombinant expression vector containing the sequence of the above nucleic acid. There are also presented a variant of the precursor protein, a method for producing the target peptide Pep, as well as using an amphiphilic peptide for the recombinant production of the antimicrobial target peptide.

EFFECT: group of inventions provides the higher yield of the target peptides.

24 cl, 11 dwg, 1 tbl, 7 ex

FIELD: veterinary medicine.

SUBSTANCE: agent reducing sexual desire and interrupting estruation is described, and also protecting against unwanted pregnancy.

EFFECT: reduced waiting period of the agent action, increase in safety and efficacy of the agent in reducing the concentration of hormones, reduction of recovery time of sexual function after taking the agent, ease of administration of the agent.

7 cl, 6 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to biotechnology. Self-assembling peptide nanoparticles (SAPN) containing T-cell epitopes and/or B-cell epitopes are described. According to the invention, the nanoparticles consist of aggregates of a continuous peptide chain comprising two oligomerisation domains bounded by a linker segment, wherein one or two oligomerisation domains contain the T-cell epitopes and/or the B-cell epitopes within their peptide sequence.

EFFECT: nanoparticles are effective as vaccines and adjuvants.

41 cl, 8 dwg, 26 tbl, 15 ex

FIELD: chemistry.

SUBSTANCE: invention relates to a method for chemical conversion of a peptide chain into a peptide thioether. A -C(=X)-R1 group is incorporated into a thiol group of a cysteine residue and the obtained peptide then reacts in an organic solvent with a compound having a substituted group of formula: NH-C(=Y)NHR3, and a -NH-C(=Y)NHR3 group binds in an addition reaction with the carboxyl group of the peptide bond at the N-terminal side of the cysteine residue, through which the peptide bond is broken and the peptide moiety at the C-terminal end is cut off. When the obtained peptide chain, having a -NH-C(=Y)NHR3 group, reacts with thiol in a buffer solution, a thiol exchange reaction occurs, specifically the thiol group of the thiol compound binds with the carbon of the carbonyl to which the -NH-C(=Y)NHR3 was bound, thereby removing the -NH-C(=Y)NHR3 group.

EFFECT: achieving conversion to peptide thioether.

14 cl, 4 ex

FIELD: medicine.

SUBSTANCE: invention refers to genetic engineering and can be used for methane-producing cell permeability control. What is prepared is a polypeptide able to permeate into a methane-producing cell and to increase its permeability, characterised by an amino acid sequence SEQ ID NO:117, 118 or 119 or being at least 90% identical to the above sequence, or at least 15 sequential amino acids of the above sequence. What is also prepared is a polynucleotide coding the above polypeptide cloning and expressing vectors used for producing host cells producing the polypeptide or used for the vector replication. The polypeptide can contain a fluorescent tag on an N-terminal amino acid residue.

EFFECT: invention enables providing higher methane-producing cell permeability.

18 cl, 35 dwg, 3 ex

FIELD: chemistry.

SUBSTANCE: invention relates to compounds of formula (I) and (II) and a method for [18F]-fluorination of biomolecules biomolecule, particularly peptides, using a compound of formula (I).

EFFECT: obtained 18F-labelled compounds are useful as imaging agents, especially in positron emission tomography (PET).

10 cl, 4 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: present invention refers to biotechnology, more specifically to allergen modifications to reduce an allergenic capacity thereof, and may be used in medicine. A modified allergen is prepared by sequential modification of all primary amino groups or a portion thereof of lysine and arginine residues of an allergen molecule with using potassium cyanate and phenylglyoxal and used as an ingredient of a pharmaceutical composition for treating allergy.

EFFECT: invention provides preparing the modified allergen possessing the reduced allergenic capacity as compared to a respective native allergenic material and allergoids prepared by modification by either cyanate, or phenylglyoxal.

9 cl, 12 dwg, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology and represents a method of obtaining a polypeptide in a culture of mammalian cells (versions) and a medium for cultivation of the mammalian cells. The claimed invention can be used for obtaining the polypeptide of interest in great amounts. The method includes obtaining the cell culture, which contains the mammalian cells containing a nucleic acid, which codes the polypeptide of interest, and an initial medium for cell cultivation, with a volume of the initial medium for cell cultivation constituting approximately 60-99% of a volume of the desired cell cultivation medium. The nutritional medium for cultivation is added to the cell culture, with a volume of the nutritional medium for cell cultivation constituting approximately 1-40% of a volume of the cell cultivation medium. The obtained medium for cell cultivation represents a medium for cell cultivation, containing from approximately 7 mM to approximately 30 mM of leucine, from approximately 7 mM to approximately 30 mM of lysine, from approximately 7 mM to approximately 30 mM of threonine, from approximately 7 mM to approximately 30 mM of proline and from approximately 7 mM to approximately 30 mM of valine. The cell culture is kept under conditions, which allow expressing the polypeptide of interest.

EFFECT: claimed invention makes it possible to obtain the polypeptide of interest with a higher output.

18 cl, 15 dwg, 16 tbl, 7 ex

FIELD: chemistry.

SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.

EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.

27 cl, 8 dwg, 21 tbl, 11 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.

EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.

22 cl, 7 dwg, 2 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention refers to biotechnology, specifically to VEGF-A specific binding proteins, and can be used in medicine for treating pathological angiogenesis in mammals. The antiangiogenic protein contains one ankyrin recurrent domain consisting of a N-terminal capping module of ankyrin recurrence, a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GH7EIVEVLLK8GADVNA (SEQ ID NO:5), wherein 1 represents an amino acid residue specified in A, N, R, V, Y, E, H, I, K, L, Q, S and T; 2 is specified in S, A, N, R, D, F, L, P, T and Y; 3 is specified in T, V, S, A, L and F; 4 is specified in W, F and H; 5 is specified in P, I, A, L, S, T, V and Y; 6 is specified in W, F, I, L, T and V; 7 is specified in L or P and 8 is specified in A, H, N and Y; a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GHLEIVEVLLK7GADVNA (SEQ ID NO:1), wherein 1, 2, 3, 4, 5, 6 and 7 independently represents an amino acid residue specified in the group of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y, and a C-terminal capping module.

EFFECT: invention enables producing an antiangiogenic binding VEGF-A165 with Kd less than 10-7 M protein, which inhibits binding VEGF-A165 to VEGFR-2.

12 cl, 4 dwg, 4 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to the field of biotechnology, namely to obtaining oligopeptide compounds, containing a motive, interacting with a proliferating cell nuclear antigen (PCNA) and can be used in medicine. The oligopeptide compound consists of 14-70 amino acids and contains. a PCNA-interacting motive, representing [K/R]-[F/Y/W]-[L/I/V/A]-[L/I/V/A]-[K/R], at least one signal sequence of nuclear localisation and at least one signal sequence of penetration into a cell, with the PCNA-interacting motive being located towards an N-end relative to the signal sequence.

EFFECT: invention makes it possible to carry out the efficient treatment of hyperproliferative disorders by the application of the oligopeptide compound in cyctostatic therapy or in radiotherapy as a sensitising substance.

34 cl, 6 dwg, 4 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to biotechnology, more specifically to MUC1 cytoplasmic domain peptides, and can be used in the anticancer therapy. A method for inhibiting MUC1-positive cancer cell in an individual involves administering into an individual the MUC1-peptide of the length of at least 6 sequential MUC1 residues and no more than 20 sequential MUC1residues and containing the sequence CQCRRK, wherein the amino terminal cysteine from CQCRRK is closed at its NH2 terminal by at least one amino acid residue, which shall not conform with the native transmembrane sequence MUC-1. Alternatively, there can be used MUC-1 peptide of the length of at least sequential MUC1 residues and no more than 20 sequential MUC1 residues, which contains the sequence CQCRRK with all amino acid residues of the above peptide being D-amino acids.

EFFECT: invention enables inhibiting MUC1oligomerisation effectively and inducing the tumour cell apoptosis and the tumour tissue necrosis in vivo.

80 cl, 16 dwg, 1 tbl, 3 ex

FIELD: metallurgy.

SUBSTANCE: invention relates to casein succinylate of iron (III) wherein iron content varies from 4.5 wt % to 7 wt %, water solubility exceeds 92% while phosphorus-to-nitrogen ratio exceeds 5 wt %.

EFFECT: additionally, invention relates to production of iron (III) and to pharmaceutical composition containing casein succinylate of iron (III).

17 cl, 4 tbl, 9 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: presented group of inventions refers to biotechnology, and concerns a DLK1-Fc fused protein and using it for the metastases inhibition, a polynucleotide coding such a protein, an expression vector containing the polynucleotide, a host cell producing the above fused protein, a method for producing the fused protein by culturing the above host cell, a composition containing the above fused protein, and a method for the metastases inhibition. The characterised fused protein contains a DLK1 extracellular soluble domain consisting of the amino acid sequence SEQ ID NO:4 and Fc domain of a human antibody.

EFFECT: group of inventions can be used for preparing a therapeutic agent for reduction of cancer cell migration and the metastases inhibition.

11 cl, 36 dwg, 3 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to biochemistry. Application of a fused protein to obtain a composition for the body weight reduction is described. The fused protein contains a domain of transduction, a signal of mitochondrial localisation and a domain of a mitochondrial factor of transcription A, binding polynucleotide (TFAM), containing a group with high mobility. Methods of treating obesity by means of the said protein are described.

EFFECT: invention extends an arsenal of means for treating obesity.

9 cl, 5 dwg, 2 ex

FIELD: biotechnology.

SUBSTANCE: invention relates to a method of production of casein calcium chloride of technical casein by precipitation, and can be used in microbiological studies for production of components of storing media of cultures of microorganisms, and also production of calcium co-precipitates for food industry.

EFFECT: improvement of the method.

2 cl, 1 tbl, 5 ex

FIELD: biotechnology.

SUBSTANCE: biologically active peptide is obtained, which has curative effect against Alzheimer disease, and consisting of the amino acid sequence Ala-Trp-Lys-Val-Leu-Ser-Pro-Gln-Gly-Gly-Gly-Pro-Trp-Asp-Ser-Val-Ala.

EFFECT: invention enables to use the resulting peptide to create a drug effective in the therapy of Alzheimer disease.

1 dwg, 2 ex

Up!