Agent with antitumor activity based on arabinogalactan nanocomposites with selenium and methods for prepariation of such nanobiocomposites

FIELD: pharmacy.

SUBSTANCE: method of agent production includes interation of raw arabinogalactan and selenium dioxide or selenious acid salt in a solvent followed by precipitation in ethanol or acetone, or other organic solvent capable of mixing with water. The peculiarity of this method is that the process is carried out at the temperature of 20-25°C, stable selenium nanoparticles size is 0.5-250 nm, and raw arabinogalactan or arabinogalactan specially purified from phenolic impurities is used as the raw materila, while water or dimethylsulfoxide, or formamide are used as solvents.

EFFECT: soluble stable nanocomposites providing antitumor activity, in dry form.

3 cl, 7 dwg, 11 ex

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: first step includes obtaining low-hydroxylated insoluble fullerenols by reacting concentrated fullerene solution in o-xylene with aqueous ammonia solution in the presence of a tetrabutylammonium hydroxide phase-transfer catalyst at 35-40°C. At the second step, the obtained low-hydroxylated insoluble fullerenols are hydroxylated to transform them into a water-soluble form by mixing with 6-15% aqueous hydrogen peroxide solution and heating for 4-5 hours at 65°C. Water-soluble fullerenols are then precipitated from an alcohol-containing solution.

EFFECT: simplifying the method while preserving quality characteristics and full extraction of the end product.

2 cl, 1 dwg, 4 tbl, 3 ex

FIELD: chemistry.

SUBSTANCE: invention relates to nanotechnology, particularly a method of producing aspirin nanocapsules in a carrageenan envelope. The disclosed method includes preparing an aspirin suspension in benzene; dispersing the obtained mixture into a carrageenan suspension in butanol in the presence of an E472c preparation while mixing at 1000 rps; adding tetrachloromethane; filtering the obtained nanocapsule suspension and drying at room temperature.

EFFECT: method provides a simpler and faster process of producing nanocapsules and increases mass output.

1 dwg, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to encapsulation, particularly to a method of producing albendazole nanocapsules in a sodium alginate envelope. The disclosed method includes adding albendazole to a sodium alginate suspension in hexane in the presence of an E472c preparation while mixing at 1000 rps. The weight ratio of albendazole and sodium alginate is 1:3 or 3:1. Further, 1,2-dichloroethane is added. The obtained suspension of nanocapsules is filtered, washed and dried. The process of producing the nanocapsules is carried out at 25°C for 20 minutes.

EFFECT: invention provides a simpler and faster process of producing nanocapsules, reduces losses during production thereof (high mass output).

3 ex, 1 dwg

FIELD: chemistry.

SUBSTANCE: invention relates to encapsulation, particularly a method of producing resveratrol nanocapsules in an envelope made of low- or highly esterified apple or citrus pectin. According to the disclosed method, resveratrol is dispersed in a suspension of low- or highly esterified apple or citrus pectin in benzene in the presence of an E472c preparation while stirring at 1000 rps. Tetrachloromethane is then added. The obtained suspension of nanocapsules is filtered and dried. The process of producing the nanocapsules is carried out at 25°C for 10 minutes.

EFFECT: invention provides a simpler and faster process of producing nanocapsules, reduces losses during production thereof (high mass output).

9 ex, 1 dwg

FIELD: nanotechnology.

SUBSTANCE: according to the invention method, albendazole is added to the suspension of sodium alginate in butanol in the presence of the preparation E472s when stirring at 1000 revolutions per second. The mass ratio of albendazole and sodium alginate is 1:3 or 3:1. Then acetonitrile is added. The resulting suspension of the nanocapsules is filtered, washed, and dried. The process of production of nanocapsules is carried out at 25°C for 20 min.

EFFECT: simplification and acceleration of the process of production of nanocapsules, reduction of losses in their production.

1 dwg, 2 ex

FIELD: chemistry.

SUBSTANCE: according to the method a suspension of resveratrol in heptane was dispersed into a suspension of xanthan gum in butanol in the presence of E472c under stirring at the rate of 1000 rev/s. A mixture of benzene and water taken at a volume ratio of 5:1 or 3:1 was added to the said suspension. The resulted suspension of nanocapsules was filtered, washed and dried. The process was performed at a temperature of 25°C within 10 min.

EFFECT: simplified and fast process of nanocapsule production, reduced process losses.

4 ex, 2 dwg

FIELD: nanotechnology.

SUBSTANCE: suspension of aspirin in benzene is produced. The resulting mixture is dispersed into suspension of sodium alginate in butanol in the presence of the preparation E472s when stirring at 1000 rpm/sec. Then chloroform is poured, the resulting suspension of nanocapsules is filtered and dried at room temperature.

EFFECT: simplification and acceleration of the process of production of the nanocapsules, and increase in the yield by weight.

1 dwg, 4 ex

FIELD: medicine.

SUBSTANCE: invention represents a method for preparing a sterile nanoemulsion of perfluororganic compounds (PFOC) involving: adding a PFOC mixture to an aqueous solution of a stabilising agent; homogenising the PFOC mixture with the aqueous solution of the stabilising agent to produce a PFOC pre-emulsion; mixing the PFOC pre-emulsion with a salt-water solution to produce the PFOC nanoemulsion; keeping the PFOC nanoemulsion at a temperature from 2 to 10°C for at least 18 hours. The method can be also implemented as follows: pre-filling a circulation loop of a PFOC nanoemulsion generating plant with the aqueous solution of the stabilising agent; adding the PFOC mixture to the aqueous solution of the stabilising agent; homogenising the PFOC mixture with the aqueous solution of the stabilising agent to produce the PFOC pre-emulsion; mixing the PFOC pre-emulsion with the salt-water solution to produce the PFOC nanoemulsion.

EFFECT: higher stability of the PFOC emulsion and prolonging the storage life.

30 cl, 7 ex, 5 tbl, 1 dwg

FIELD: nanotechnology.

SUBSTANCE: shell of the nanocapsules is used as apple or citrus high- or low-esterified pectin, and the core - as L-arginine. According to the inventive method, L-arginine is suspended in benzene, the resulting mixture is dispersed into a suspension of apple or citrus high- or low-esterified pectin in benzene in the presence of the preparation E472s while stirring 1000 revolutions per second. Then carbon tetrachloride is added, the resulting suspension of the nanocapsules is filtered and dried at room temperature. The process is carried out for 15 minutes.

EFFECT: simplification and acceleration of the process of producing the nanocapsules, and increase in the yield by weight.

6 ex

FIELD: nanotechnology.

SUBSTANCE: method of production of nanocapsules of vitamin in sodium alginate is characterized in that the shell is used as sodium alginate, and the core - as the vitamin, in a weight ratio of core:shell as 1:3. According to the method of preparing the nanocapsules the vitamin is added to a suspension of sodium alginate in benzene in the presence of the preparation E472s while stirring at 1300 rev/sec. Then hexane is added, the resulting suspension is filtered and dried at room temperature.

EFFECT: simplification and acceleration of the process of production of the nanocapsules, and increase in the yield by weight.

3 dwg, 8 ex

FIELD: chemistry.

SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.

EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.

27 cl, 8 dwg, 21 tbl, 11 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to 2-(3-amino-1-(2,4-difluorophenyl)-1H-1,2,4-triazol-5-yl)-N-methyl-4,5-dihydrobenzo[b]thieno[2,3-d]oxepin-8-carboxamide. As well as to a pharmaceutical composition containing the above compound, to the use thereof and a set for treating.

EFFECT: 2-(3-amino-1-(2,4-difluorophenyl)-1H-1,2,4-triazol-5-yl)-N-methyl-4,5-dihydrobenzo[b]thieno[2,3-d]oxepin-8-carboxamide inhibiting PI3 kinase (PI3K).

6 cl, 15 dwg, 1 tbl, 610 ex

FIELD: medicine.

SUBSTANCE: claimed invention relates to the field of biotechnology. Claimed are versions of a humanised anti-CD79b antibody, each of which is characterised by the presence of a light and heavy chain and a set of 6 CDR with a determined amino acid sequence. An epitope of the antibody from 11 amino acids is determined by the Biacore method. Disclosed are: an immunoconjugate of the antibody with a medication or means for inhibiting cell growth, where the antibody is bound with means covalently, and versions of the composition, based on an effective quantity of the immunoconjugate or the antibody, used for inhibiting B-cell proliferation; as well as a method of determining CD79b in a sample with the application of the antibody. Described are: an antibody-coding polynucleotide, as well as an expression vector and an isolated cell, containing the vector for obtaining the antibody. Disclosed are versions of applying the antibody or immunoconjugate for obtaining the medication for inhibiting the growth of CD79b-expressing cells for the treatment of an individual, affected with cancer, for the treatment of proliferative disease or for inhibiting B-cell proliferation.

EFFECT: invention provides novel antibodies, which can find further application in the therapy of proliferative CD79b-associated diseases.

91 cl, 8 tbl, 9 ex, 20 dwg

FIELD: medicine.

SUBSTANCE: invention refers to biotechnology, virology and medicine. The method provides administering a pox virus containing the defect F2L gene into a host body or a cell. What is also described is using this pox virus for producing a drug preparation for treating proliferative diseases or diseases accompanied by osteoclast hyperactivity. The invention can be used in medicine.

EFFECT: what is presented is the method of treating proliferative diseases or diseases accompanied by osteoclast hyperactivity.

28 cl, 10 dwg, 3 tbl

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to methods of obtaining heteroaryl compounds, represented by structural formulae (I) or (II): where R1-R4 have values, given in subcl. 1,14 of the formula.

EFFECT: compounds can be used for treatment or prevention of cancer, inflammatory states, immunological states, etc.

29 cl, 20 ex

FIELD: chemistry.

SUBSTANCE: invention relates to novel choline salt of 3-[2-fluoro-5-(2,3-difluoro-6-methoxybenzyloxy)-4-methoxyphenyl]-2,4-dioxo-1,2,3,4-tetrahydrothieno[3,4-d]pyrimidine-5-carboxylic acid, corresponding to formula and to its crystalline form. Crystalline form of salt (A) has characteristic peaks at diffraction angles (2θ(E)) 7.1, 11.5, 19.4, 20.3, 21.5, 22.0, 22.6, 23.5 and 26.2 in diagram of powder diffraction of X-rays, characteristic peaks of values of chemical shifts (δ(ppm)) 155.8, 149.8, 145.3, 118.0, 113.7, 111.6, 110.3, 98.1, 69.8, 58.7, 57.1 and 55.5 in solid-state 13C NMR spectrum and characteristic peaks of values of chemical shifts (δ(ppm)) -131.6, -145, and -151.8 in solid-state 19F NMR spectrum, as well as endothermic peak about 213°C in diagram of differential-thermal analysis.

EFFECT: compound has excellent solubility and stability in storage.

5 cl, 5 dwg, 3 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology, specifically to novel hetero-multimeric proteins obtained from modified ubiquitin, and can be used in medicine to treat or diagnose diseases associated with hyperprodution of the extradomain B of fibronectin (ED-B). The protein includes two monomeric ubiquitin links which are differently modified through substitutions of at least 6 amino acids in positions 4, 6, 8, 62, 63, 64, 65 and 66 of SEQ ID NO: 1. In the first monomer link the substitutions include: F4W, K6(H, W or F), Q62N, E64(K, R or H), S65(L, F or W), T66(S or P), and in the second monomer link: K6(T, N, S or Q), L8(Q, T, N or S), Q62(W or F), K63(S, T, N or Q), E64(N, S, T or Q), S65(F or W), T66(E or D).

EFFECT: invention enables to obtain a modified heterodimeric ubiquitin protein, capable of binding with ED-B with high affinity.

28 cl, 18 dwg, 3 tbl, 7 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of organic chemistry, namely to polymorphs of form 1 and form 2 of (-)trans-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolon-I-yl)-4-(1H-indol-3-yl)pyrrolidin-2,5-dione. Invention also relates to methods of obtaining said polymorphs and pharmaceutical composition on their basis.

EFFECT: novel polymorphs of (-)trans-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolon-I-yl)-4-(1H-indol-3-yl)pyrrolidin-2,5-dione are obtained, useful in cancer treatment.

23 cl, 26 dwg, 2 tbl, 27 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.

EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.

22 cl, 7 dwg, 2 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to pharmaceutical industry, namely to selenium nanocomposites of natural hepatotrophic galactose-containing polysaccharide matrixes, representing water-soluble orange-red powders containing zerovalent selenium (Se0) nanoparticles sized 1-100 nm in the quantitative content of 0.5 - 60 wt %, possessing antioxidant activity for treating and preventing redox-related pathologies, particularly for treating toxic liver damage, to a method for producing and to an antioxidant agent containing the above nanocomposites.

EFFECT: invention provides the targeted agent delivery to liver cells, as well as higher agent accessibility and lower toxic action of selenium.

7 cl, 11 ex, 4 tbl

Up!