New allergen

FIELD: biotechnology.

SUBSTANCE: invention relates to biotechnology, namely to novel horse allergens, and can be used in medicine for prophylactic or therapeutic treatment or diagnostics of type I allergy in horses. Horse allergen is obtained, which represents secretoglobin with molecular weight of 15 kDa in non-reducing conditions and contains first peptide chain with molecular weight of approximately 5 kDa and second peptide chain with molecular weight of approximately 10 kDa, linked to each other. Recombinant form of said allergen is also obtained.

EFFECT: invention enables to obtain recombinant horse allergen with completely determined amino acid sequence.

13 cl, 10 dwg, 3 tbl, 8 ex

 



 

Same patents:

FIELD: medicine.

SUBSTANCE: invention refers to medicine. What is presented is a method for the prediction of the postpartum osteopenic syndrome involving studying VDR gene polymorphism Fok-I and predicting the osteopenic syndrome having the genotypes Ff or ff detected. If the genotype FF of the VDR gene polymorphism Fok-I is detected, the VDR gene polymorphism ApaI, BsmI and TaqI are studied additionally. If having at least one of the VDR genotypes AA, Aa ApaI, BB, Bb BsmI and Tt, tt TaqI detected, the postpartum osteopenic syndrome is predicted to develop.

EFFECT: presented method enables predicting the developing postpartum osteopenic syndrome even before the onset of pregnancy, or at any gestational age.

10 ex

FIELD: medicine.

SUBSTANCE: DNA is recovered from peripheral venous blood which is followed by a genetic typing of the APOE gene and detecting polymorphous alleles APOE*2, APOE*3, APOE*4; if the assays shows any genetic types containing alleles APOE*2, a high risk of endometrial cancer is predicted.

EFFECT: invention provides a highly specific criterion for predicting the risk of hyperproliferative diseases of the endometrium, including endometrioid adenocarcinoma in females with hyperplastic processes in the endometrium.

2 dwg, 10 tbl, 4 ex

FIELD: medicine.

SUBSTANCE: invention relates to medicine, namely to a method of diagnosing bipolar affective disorder. The essence of the method consists in the fact that reliable differences in the spectrum of protein distribution in blood serum without proteins albumin, immunoglobulin G, immunoglobulin A, antitrypsin, transferin and haploglobin in patients with endogenic psychosis. If protein spots are detected on electrophoretic gel in areas with the molecular weight of 200, 84, 75, 49, 40 kDa in the patient with endogenic psychosis, bipolar affective disorder is diagnosed.

EFFECT: application of the claimed method makes it possible to increase accuracy in diagnostics being simple in realisation.

2 ex

FIELD: medicine.

SUBSTANCE: method involves determining female serum cytotoxicity to male lymphocytes, including a combined culture with reference male and analysed female serum in a 96-well tray in the presence of the nutrient medium RPMI 1640 in a CO2 incubator. One day later, lymphocytes are counted in the well in a Goryaev's chamber with the male (reference) and female (analysed) serum. That is followed by determining a cytotoxic index (CI), which represents a quotient of the analysed cell count and the reference cell count. The normal cytotoxic index makes approximately 0.7 and less.

EFFECT: invention enables studying the responses of female humoral immune factors to male antigens and evaluating a risk of miscarriage, early spontaneous abortions and missed miscarriages.

1 ex

FIELD: medicine.

SUBSTANCE: invention relates to the field of medicine and is intended for the diagnostics of an occlusive affection of vessels in patients with cardiovascular diseases. The age, the level of total homocysteine in blood, the presence of C677T polymorphism mutations in the gene of methyletetrahydrofolate reductase, factor V gene G1691A Leiden mutation, 675 4G/5G polymorphism mutations in the gene of the plasminogen activator inhibitor type I are determined in the patient, after which a value of the discriminant function is calculated by formula. In case of D>0, the presence of the occlusive affection of vessels is diagnosed, if D<0, the absence is diagnosed.

EFFECT: invention provides the effective method for the diagnostics of the occlusive affection of vessels in the patients with cardiovascular diseases.

3 ex

FIELD: medicine.

SUBSTANCE: method includes the determination of an inhibiting impact of a solution of highly-toxic anticholinesterase poison on cholinesterase activity, represented by acetylcholinesterase of human blood erythrocytes, in the presence and in the absence of a substrate, represented by acetylthiocholiniodide. The inhibiting impact of the solution of highly-toxic anticholinesterase poison on the activity of acetylcholinesterase of the human blood erythrocytes is determined first in the presence of the substrate, and then in its absence. An analysed sample is preliminarily diluted by 10 or 100 times to obtain the inhibiting effect on acetylcholinesterase of the human blood erythrocytes in the presence and in the absence of the substrate within 25-75%. After that, the value of the protective effect of acetylthiocholiniodide and the obtained calculated value is compared with table values, determined experimentally in advance for each particular highly-toxic anticholinesterase poison. If the calculated values coincide with the table values, a conclusion about the presence of a respective highly-toxic anticholinesterase poison in the analysed sample is made.

EFFECT: increase of safety.

2 ex

FIELD: medicine.

SUBSTANCE: technique is implemented by biochemical blood analysis followed by determining a diagnostic index by formula: D=X1×K1+X2×K2+X3×K3+X4×K4+const, wherein the values X are described by the biological parameters: X1 is the ceruloplasmin concentration, g/l; X2 is the creatinine concentration, mcmole/l; X3 is the total protein concentration, g/l; X4 is the albumin concentration, g/l; K1, K2, K3; K4 are coefficients: K1=10.4, K2=-0.04, K3=-0.10, K4=0.26, const=-6.84. If D is more than 0, the uncomplicated gestation course is stated with certainty. If D is less than 0, the threatening miscarriage is predicted.

EFFECT: method enables the timely detection of a group of the threatening miscarriage risk, and enables the correct classification.

3 ex

FIELD: medicine.

SUBSTANCE: group of inventions relate to medicine and deals with method of diagnosing neurodegenerative disease in individual, including the following stages (i) determination of one or several parameters, selected from group, consisting of 3ab40 or value of calculated parameter, selected from group, consisting of 2ab40+3ab40, 2ab40+3ab40+2ab42+3ab42 and 1ab40+2ab40+1ab42+2ab42; (ii) comparison of parameter value with standard value, corresponding to value of said parameter in standard sample; and (iii) diagnostics of neurodegenerative disease, in case if increase of parameter value in comparison with standard value is observed. Group of inventions also deals with method of detecting stage, preceding neurodegenerative disease, method of differentiating neurodegenerative disease from stage, preceding said neurodegenerative disease.

EFFECT: group of inventions provide high sensitivity and specificity of detection methods.

13 cl, 12 ex, 14 dwg, 12 tbl

FIELD: medicine.

SUBSTANCE: invention refers to medicine, namely to a method for the prediction of acquired myopia in school children. The substance of the method consists in measuring blood haemoglobin concentrations in 6-8-year-old school children to detect haemoglobin deficiency as shown by the difference of an optimum haemoglobin concentration specific for the above age and an actual haemoglobin concentration in a child. If observing no haemoglobin deficiency at the age of 6-8 years old, a low risk of acquired myopia is predicted. The haemoglobin deficiency to 1.7 g/l enables predicting a risk of acquired low myopia. If the haemoglobin deficiency is 1.7 g/l and more, a high risk of progressive myopia to be developed into moderate or high myopia is predicted.

EFFECT: using the declared method enables developing the reliable and accessible method for the prediction of myopia in the 6-8-year-old children.

2 tbl, 1 dwg, 6 ex

FIELD: medicine.

SUBSTANCE: invention relates to method of diagnosing rheumatoid arthritis, method of determining therapeutic agent for treatment of rheumatoid arthritis and set for realisation of methods. Methods are characterised by the fact that include stage of measuring amount of talin in plasma or serum of animal subject. Said measurement is carried out, for instance, by immunologic method with application of antibody, binding with talin. If amount of talin is higher than its average value in control subject without rheumatoid arthritis, rheumatoid arthritis is diagnosed in subject. In case of reduction of talin amount after introduction of therapeutic agent in comparison with amount of talin before introduction, therapeutic effect is stated. Set in accordance with claimed invention contains solid-phase carrier, to which antibody, binding with talin, is attached.

EFFECT: increased efficiency of diagnostics.

9 cl, 4 tbl, 4 ex, 3 dwg

FIELD: chemistry.

SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.

EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.

27 cl, 8 dwg, 21 tbl, 11 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.

EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.

22 cl, 7 dwg, 2 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention refers to biotechnology, specifically to VEGF-A specific binding proteins, and can be used in medicine for treating pathological angiogenesis in mammals. The antiangiogenic protein contains one ankyrin recurrent domain consisting of a N-terminal capping module of ankyrin recurrence, a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GH7EIVEVLLK8GADVNA (SEQ ID NO:5), wherein 1 represents an amino acid residue specified in A, N, R, V, Y, E, H, I, K, L, Q, S and T; 2 is specified in S, A, N, R, D, F, L, P, T and Y; 3 is specified in T, V, S, A, L and F; 4 is specified in W, F and H; 5 is specified in P, I, A, L, S, T, V and Y; 6 is specified in W, F, I, L, T and V; 7 is specified in L or P and 8 is specified in A, H, N and Y; a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GHLEIVEVLLK7GADVNA (SEQ ID NO:1), wherein 1, 2, 3, 4, 5, 6 and 7 independently represents an amino acid residue specified in the group of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y, and a C-terminal capping module.

EFFECT: invention enables producing an antiangiogenic binding VEGF-A165 with Kd less than 10-7 M protein, which inhibits binding VEGF-A165 to VEGFR-2.

12 cl, 4 dwg, 4 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to the field of biotechnology, namely to obtaining oligopeptide compounds, containing a motive, interacting with a proliferating cell nuclear antigen (PCNA) and can be used in medicine. The oligopeptide compound consists of 14-70 amino acids and contains. a PCNA-interacting motive, representing [K/R]-[F/Y/W]-[L/I/V/A]-[L/I/V/A]-[K/R], at least one signal sequence of nuclear localisation and at least one signal sequence of penetration into a cell, with the PCNA-interacting motive being located towards an N-end relative to the signal sequence.

EFFECT: invention makes it possible to carry out the efficient treatment of hyperproliferative disorders by the application of the oligopeptide compound in cyctostatic therapy or in radiotherapy as a sensitising substance.

34 cl, 6 dwg, 4 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to biotechnology, more specifically to MUC1 cytoplasmic domain peptides, and can be used in the anticancer therapy. A method for inhibiting MUC1-positive cancer cell in an individual involves administering into an individual the MUC1-peptide of the length of at least 6 sequential MUC1 residues and no more than 20 sequential MUC1residues and containing the sequence CQCRRK, wherein the amino terminal cysteine from CQCRRK is closed at its NH2 terminal by at least one amino acid residue, which shall not conform with the native transmembrane sequence MUC-1. Alternatively, there can be used MUC-1 peptide of the length of at least sequential MUC1 residues and no more than 20 sequential MUC1 residues, which contains the sequence CQCRRK with all amino acid residues of the above peptide being D-amino acids.

EFFECT: invention enables inhibiting MUC1oligomerisation effectively and inducing the tumour cell apoptosis and the tumour tissue necrosis in vivo.

80 cl, 16 dwg, 1 tbl, 3 ex

FIELD: metallurgy.

SUBSTANCE: invention relates to casein succinylate of iron (III) wherein iron content varies from 4.5 wt % to 7 wt %, water solubility exceeds 92% while phosphorus-to-nitrogen ratio exceeds 5 wt %.

EFFECT: additionally, invention relates to production of iron (III) and to pharmaceutical composition containing casein succinylate of iron (III).

17 cl, 4 tbl, 9 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: presented group of inventions refers to biotechnology, and concerns a DLK1-Fc fused protein and using it for the metastases inhibition, a polynucleotide coding such a protein, an expression vector containing the polynucleotide, a host cell producing the above fused protein, a method for producing the fused protein by culturing the above host cell, a composition containing the above fused protein, and a method for the metastases inhibition. The characterised fused protein contains a DLK1 extracellular soluble domain consisting of the amino acid sequence SEQ ID NO:4 and Fc domain of a human antibody.

EFFECT: group of inventions can be used for preparing a therapeutic agent for reduction of cancer cell migration and the metastases inhibition.

11 cl, 36 dwg, 3 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to biochemistry. Application of a fused protein to obtain a composition for the body weight reduction is described. The fused protein contains a domain of transduction, a signal of mitochondrial localisation and a domain of a mitochondrial factor of transcription A, binding polynucleotide (TFAM), containing a group with high mobility. Methods of treating obesity by means of the said protein are described.

EFFECT: invention extends an arsenal of means for treating obesity.

9 cl, 5 dwg, 2 ex

FIELD: biotechnology.

SUBSTANCE: invention relates to a method of production of casein calcium chloride of technical casein by precipitation, and can be used in microbiological studies for production of components of storing media of cultures of microorganisms, and also production of calcium co-precipitates for food industry.

EFFECT: improvement of the method.

2 cl, 1 tbl, 5 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to compound, represented by the following formula

,

or its pharmaceutically acceptable salt. In claimed formula each symbol has values, determined in formula of invention. Versions of formula [I] compound and particular compounds are also objects of invention. In addition, invention relates to pharmaceutical composition, ITK inhibitor and means for treatment or prevention of inflammatory diseases, allergic diseases, autoimmune diseases, transplant rejection and other diseases and methods of treating said diseases.

EFFECT: claimed compounds inhibit induced T-cellular kinase (ITK).

32 cl, 86 tbl, 387 ex

Up!