Transdermal therapeutic system for 5-aminolevulinic acid hydrochloride

FIELD: medicine.

SUBSTANCE: group of inventions relates to medicine. Disclosed is transdermal therapeutic system, which includes active substance impermeable back layer, containing active substance, polymer matrix and separable protective layer, wherein active substance is represented by 5-aminolevulinic acid hydrochloride and polymer matrix basic polymer is adhesive polyacrylate. Transdermal therapeutic system is applicable for diagnosing and treating of skin cancer pre-stages, such as actinic keratosis, as well as skin oncological diseases.

EFFECT: transdermal therapeutic system is fairly well sticks to skin and does not cause irritation thereof.

15 cl, 1 dwg, 4 ex

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.

EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.

27 cl, 8 dwg, 21 tbl, 11 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to 2-(3-amino-1-(2,4-difluorophenyl)-1H-1,2,4-triazol-5-yl)-N-methyl-4,5-dihydrobenzo[b]thieno[2,3-d]oxepin-8-carboxamide. As well as to a pharmaceutical composition containing the above compound, to the use thereof and a set for treating.

EFFECT: 2-(3-amino-1-(2,4-difluorophenyl)-1H-1,2,4-triazol-5-yl)-N-methyl-4,5-dihydrobenzo[b]thieno[2,3-d]oxepin-8-carboxamide inhibiting PI3 kinase (PI3K).

6 cl, 15 dwg, 1 tbl, 610 ex

FIELD: medicine.

SUBSTANCE: claimed invention relates to the field of biotechnology. Claimed are versions of a humanised anti-CD79b antibody, each of which is characterised by the presence of a light and heavy chain and a set of 6 CDR with a determined amino acid sequence. An epitope of the antibody from 11 amino acids is determined by the Biacore method. Disclosed are: an immunoconjugate of the antibody with a medication or means for inhibiting cell growth, where the antibody is bound with means covalently, and versions of the composition, based on an effective quantity of the immunoconjugate or the antibody, used for inhibiting B-cell proliferation; as well as a method of determining CD79b in a sample with the application of the antibody. Described are: an antibody-coding polynucleotide, as well as an expression vector and an isolated cell, containing the vector for obtaining the antibody. Disclosed are versions of applying the antibody or immunoconjugate for obtaining the medication for inhibiting the growth of CD79b-expressing cells for the treatment of an individual, affected with cancer, for the treatment of proliferative disease or for inhibiting B-cell proliferation.

EFFECT: invention provides novel antibodies, which can find further application in the therapy of proliferative CD79b-associated diseases.

91 cl, 8 tbl, 9 ex, 20 dwg

FIELD: medicine.

SUBSTANCE: invention refers to biotechnology, virology and medicine. The method provides administering a pox virus containing the defect F2L gene into a host body or a cell. What is also described is using this pox virus for producing a drug preparation for treating proliferative diseases or diseases accompanied by osteoclast hyperactivity. The invention can be used in medicine.

EFFECT: what is presented is the method of treating proliferative diseases or diseases accompanied by osteoclast hyperactivity.

28 cl, 10 dwg, 3 tbl

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to methods of obtaining heteroaryl compounds, represented by structural formulae (I) or (II): where R1-R4 have values, given in subcl. 1,14 of the formula.

EFFECT: compounds can be used for treatment or prevention of cancer, inflammatory states, immunological states, etc.

29 cl, 20 ex

FIELD: chemistry.

SUBSTANCE: invention relates to novel choline salt of 3-[2-fluoro-5-(2,3-difluoro-6-methoxybenzyloxy)-4-methoxyphenyl]-2,4-dioxo-1,2,3,4-tetrahydrothieno[3,4-d]pyrimidine-5-carboxylic acid, corresponding to formula and to its crystalline form. Crystalline form of salt (A) has characteristic peaks at diffraction angles (2θ(E)) 7.1, 11.5, 19.4, 20.3, 21.5, 22.0, 22.6, 23.5 and 26.2 in diagram of powder diffraction of X-rays, characteristic peaks of values of chemical shifts (δ(ppm)) 155.8, 149.8, 145.3, 118.0, 113.7, 111.6, 110.3, 98.1, 69.8, 58.7, 57.1 and 55.5 in solid-state 13C NMR spectrum and characteristic peaks of values of chemical shifts (δ(ppm)) -131.6, -145, and -151.8 in solid-state 19F NMR spectrum, as well as endothermic peak about 213°C in diagram of differential-thermal analysis.

EFFECT: compound has excellent solubility and stability in storage.

5 cl, 5 dwg, 3 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology, specifically to novel hetero-multimeric proteins obtained from modified ubiquitin, and can be used in medicine to treat or diagnose diseases associated with hyperprodution of the extradomain B of fibronectin (ED-B). The protein includes two monomeric ubiquitin links which are differently modified through substitutions of at least 6 amino acids in positions 4, 6, 8, 62, 63, 64, 65 and 66 of SEQ ID NO: 1. In the first monomer link the substitutions include: F4W, K6(H, W or F), Q62N, E64(K, R or H), S65(L, F or W), T66(S or P), and in the second monomer link: K6(T, N, S or Q), L8(Q, T, N or S), Q62(W or F), K63(S, T, N or Q), E64(N, S, T or Q), S65(F or W), T66(E or D).

EFFECT: invention enables to obtain a modified heterodimeric ubiquitin protein, capable of binding with ED-B with high affinity.

28 cl, 18 dwg, 3 tbl, 7 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of organic chemistry, namely to polymorphs of form 1 and form 2 of (-)trans-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolon-I-yl)-4-(1H-indol-3-yl)pyrrolidin-2,5-dione. Invention also relates to methods of obtaining said polymorphs and pharmaceutical composition on their basis.

EFFECT: novel polymorphs of (-)trans-3-(5,6-dihydro-4H-pyrrolo[3,2,1-ij]quinolon-I-yl)-4-(1H-indol-3-yl)pyrrolidin-2,5-dione are obtained, useful in cancer treatment.

23 cl, 26 dwg, 2 tbl, 27 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.

EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.

22 cl, 7 dwg, 2 tbl, 8 ex

Transdermal plaster // 2553350

FIELD: medicine.

SUBSTANCE: group of inventions relates to medicine. Described is matrix layer, suitable for application in plaster for transdermal delivery, aimed at introduction of biologically active compounds, which includes phosphate compound of tocopherol and polymer carrier. Also described is transdermal plaster and method of its production.

EFFECT: plaster makes it possible to efficiency introduce biologically active compounds.

48 cl, 15 tbl, 13 dwg, 12 ex

FIELD: medicine.

SUBSTANCE: what is described is an antiseptic sorption material having the anti-inflammatory, wound-healing, absorbent, astringent and antiseptic action representing a microfiber matrix with a disperse adsorbent attached to its fibres and containing highly porous alumina hydrate particles and zinc oxide particles. A method for making the same and a based dressing are also described.

EFFECT: material is applicable for making wound dressings having additional functional properties and maintaining the absorbing properties of the material absorbing the wound discharge, inhibiting bacterial growth inside the dressing and preventing the wound re-infection.

15 cl, 4 dwg, 2 tbl, 3 ex

FIELD: medicine.

SUBSTANCE: group of inventions refers to medicine. What is described is a transdermally absorbable formulation prepared by dissolving donepezil in an adherent plaster base, which contains a hydrophobic polymer and an absorption enhancer. The absorption enhancer represents one substance, or two or more substances specified in lauryl alcohol, triethyl citrate, isopropylmyristate, cetyl lactate, oleyl alcohol, sorbitan monooleate, polyethyleneglycol monostearate, lauromacrogol, N-methyl-2-pyrroldone and triacetin.

EFFECT: transdermally absorbable formulation can administer donepezil stably for a relatively long period of time and can provide both blood donepezil increase, and the properties of sustained release of donepezil.

4 cl, 4 dwg, 6 tbl, 26 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to a percutaneously absorbable layer having a base and an adhesive layer which is placed on the base and which comprises an adhesive agent and a therapeutic ingredient. The adhesive agent contains a mixture of resins containing 100 portions by weight of an acrylic copolymer (A) and 0.1 to 30 portions by weight of an acrylic copolymer (B) or 0.05 to 2 portions by weight of a low-molecular polyamine compound having at least two amino groups in one molecule and non-polymerising with a polymer or an oligomer formed. The adhesive layer additionally contains an organic acid. The acrylic copolymer (A) represents an acrylic copolymer, which contains acrylic ester of (meth)acrylic acid as a main monomer ingredient and contains 3 to 45 wt % of diacetone acrylamide as a target monomer ingredient, but free from a free carboxylic group. The acrylic copolymer (B) represents an acrylic copolymer, which contains acrylic ester of (meth)acrylic acid as a main monomer ingredient and contains a primary amino group and/or carboxyhydrazidase group on side chains, but free from a free carboxylic group.

EFFECT: reducing the aging period of the adhesive layer considerably.

7 cl, 8 tbl, 39 ex

Antiviral agent // 2542488

FIELD: medicine, pharmaceutics.

SUBSTANCE: group of inventions refers to an antiviral agent and aims at inactivating a wide range of viruses. The antiviral agent contains an active agent presented by particles of at least one type of iodide formed by iodine and an element formed in 4-6th periods of the 8-10th or 12-15th groups of the periodic table, Cu or Au. The above element found in the 4-6th periods of the 8-10th or 12-15th groups of the periodic table represents Sb, Ir, Ge, Sn, Tl, Pt, Pd, Bi, Fe, Co, Ni, Zn, In or Hg. What is also presented is the antiviral agent containing particles of at least one type of a cuprous compound as an active ingredient. The above cuprous compound represents chloride, acetate, sulphide, iodide, bromide, peroxide, oxide or thiocyanide.

EFFECT: using the group of inventions provides the agent having the high antiviral activity; the above agent is able to exhibit and maintain its antiviral activity easily since it requires no preparation or special washing.

5 cl, 4 tbl, 27 ex

FIELD: chemistry.

SUBSTANCE: invention relates to method of obtaining adhesive composition without application of solvent, to adhesive composition, which does not contain fillers and is obtained by said method. Method includes a) supply of highly-molecular polyisobutylene (HM PIB) into extruding device, where said HM PIB in fact does not contain fillers, solvents and plasticisers; b) mixing said HM PIB with low-molecular polyisobutylene (LM PIB) in said extruding device to form melt, which in fact does not contain filler, solvents and plasticisers; c) addition of active pharmaceutical ingredient (API) to said melt to obtain API/PIB melt; and d) passing said API/PIB melt through head to form said adhesive composition, which in fact does not contain fillers, solvents and plasticisers.

EFFECT: method of obtaining adhesive composition for production of pressure-sensitive adhesive matrix layers for transdermal delivery of medicinal media without application of inflammable solvents eliminates need in drying blocks, favourably influences environment without any release of solvent, with no undesirable remains of solvent remaining in obtained composition.

21 cl, 4 dwg, 1 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: group of inventions refers to medicine. What is described is a system of the transdermal delivery of a drug containing an effective dose of an antithrombotic agent, such as tirofiban, or its pharmaceutically acceptable salt. A dose of the delivered drug is proportional to an applied plaster size and reaches 60-85% of thrombocyte inhibition. The system enables providing the individualised treatment of patients. There are presented methods of treating various disorders, when the thrombocyte inhibition is required.

EFFECT: transdermal delivery system can deliver the drug to the patient for the prolonged period of time.

25 cl, 12 ex

FIELD: medicine.

SUBSTANCE: invention refers to medicine, particularly to a method for active substance (AS) delivery through an epidermal barrier. The declared method involves using a matrix-type transdermal patch containing a substrate, a protective tape and a polymer layer, and characterised by the fact that 10% PEG-12 dimethicone niosomes are introduced into the polymer layer of the transdermal patch; then the substrate is coated with the polymer layer. The ACs are encapsulated into the niosomes with the use of hemogeniser APV, as well as 10 wt % propylene glycol and 5 wt % isopropyl myristate.

EFFECT: improving the active substance penetration with maintaining the biological activity and prolonging the active substance action.

2 tbl, 3 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to medicine and cosmetology and can be used for the effective transdermal delivery of the wide range of active substances (AS). What is declared is a method for the transdermal delivery of the active substances as a part of PEG-12 dimethicone niosomes characterised by the fact that the AS are included into the niosomes in the concentration of 10% by homogenising gel containing 10% niosomes in the homogeniser APV.

EFFECT: invention provides the higher transdermal effect of the interstitial delivery of the AS as a part of the niosomes.

3 tbl, 2 dwg

FIELD: medicine.

SUBSTANCE: invention refers to medicine. What is described is a method for producing a therapeutic tissue involving producing a polymer base containing alginic acid salt, administering an active substance in a therapeutically effective amount, agitating the mixture in a slow-speed mixer, applying the prepared composition on a textile material containing at least 50% cellulose fibres, while the composition of the polymer with the active substance is applied on the textile material through a mesh template at a cell size of 200 to 450 mcm to generate a continuous polymer layer on the face surface of the textile material not penetrating to the inner side.

EFFECT: method enables extending the range of therapeutic agents and biologically active additives, enabling variation of their concentration that causes their concentration in treating various diseases, enables fast transformation of the technological process and its cost-effectiveness.

28 cl, 23 ex

FIELD: medicine.

SUBSTANCE: baseline therapy is accompanied by administering "Enterosgel" 1.5-2 hours prior to or 2 hours after a meal or medication intake in the children aged from 5 to 10 years old in an amount of 15 g 2 times a day, aged from 11 to 15 years old in an amount of 15 g 3 times a day for 7 days; "Qudesan" is administered orally with a meal before noon in age-specific doses: from 5 to 7 years old - 10-16 drops (15-24 mg), from 8 to 15 years old - 16-20 drops (24-30 mg), diluted in a small amount of boiled water or any other beverage of room temperature, once a day for 30 days; "Pantogam" is administered orally 15-20 minutes after a meal in age-specific doses: from 5 to 7 years old - 500 mg 2 times a day, from 8 to 15 years old - 500 mg 3 times a day for 30 days; the combined administration of the above preparations is repeated every 6 months.

EFFECT: method enables reducing the risk of partially controlled forms of bronchial asthma considerably by the pronounced positive synergic effect of the above drug preparations.

4 tbl

Up!