Method for producing lactoferrin, lactoferrin-containing fraction and using it

FIELD: medicine, pharmaceutics.

SUBSTANCE: group of inventions refers to biotechnology. A raw material is presented by milk, which has not been processed at a temperature of more than 55°C. The above raw material is extracted on cation-exchange resin with using a concentrated solution of sodium chloride. A solution of primary milk protein containing lactoferrin, lactoperoxidase and other foreign matters is produced. The solution of primary milk protein is purified on cation exchange resin balanced with acetate buffer in the concentration of 50 mM at pH from 4 to 9. An elution procedure is ensured with using acetate buffer solutions in the concentration of 50 mM with the different concentrations of the sodium chloride solution - from 0.02 to 1.5 M. A lactoferrin-containing fraction is collected. The fraction contains more than 95% pure lactoferrin and is substantially free from lipopolysaccharides, endotoxins and angiogenin and has an iron saturation level from 9% to 20%. The produced fraction is applicable to accelerate maturation of a newborn's gastrointestinal tract or to recover a post-gastroenteritis intestinal mucosa, to increase monocyte activity and to improve the cytotoxic function of killer cells, as an anti-inflammatory agent, to reduce expression of anti-inflammatory cytokines, to inhibit or eliminate bacteria, to treat the diseases associated with bacterial films, to prepare solutions or ointments for wound cleaning or eye care, and to treat infectious respiratory diseases.

EFFECT: method for producing lactoferrin, the lactoferrin-containing fraction and using it are presented.

15 cl, 4 tbl, 11 dwg

 



 

Same patents:

FIELD: chemistry.

SUBSTANCE: invention relates to novel hemin derivatives of general formula (I) where R1 and R2 both represent ArgNH2, Arg(NO2)OMe, GlyNH2, SerNH2, SerOH, GlyOH, Glu(OH)OH, Glu(ArgNH2)ArgNH2, Glu(SerOMe)SerOMe, Glu(NHCH2CH2OH)NHCH2CH2OH, Glu(SerNH2)SerNH2, Glu(GlyNH2)GlyNH2 or Glu(GlyOMe)GlyOMe; Men+ represents Fe2+ or Fe3+; Hal- represents F-, Cl-, Br- or I-, or a pharmaceutically acceptable salt thereof. Also disclosed are a pharmaceutical composition, a medicinal agent and a method of producing compounds of general formula (I) (versions).

EFFECT: novel hemin derivatives disclosed herein have high water-solubility, antibacterial and antiviral activity without toxicity.

28 cl, 1 dwg, 4 tbl, 18 ex

FIELD: medicine.

SUBSTANCE: what is offered is a binding agent of a pathogenic isoform of a prion protein containing lactoferrin. There are offered a method for detecting and a method for recovering the pathogenic isoform of the prion protein involving the stage of sample contacting with the binding agent of the pathogenic isoform of the prion protein and the stage of binded component separation from the binding agent of the pathogenic isoform of the prion protein contacting with the sample. The method for detecting additionally involves the stage of detection of the pathogenic isoform of the prion protein found in the component of the pathogenic isoform of the prion protein separated from the binding agent.

EFFECT: fast, simple and high-sensitive methods for detecting and recovering the pathogenic isoform of the prion protein without its enzymatic treatment with protease K.

6 cl, 2 dwg, 2 ex

FIELD: medicine; biotechnologies.

SUBSTANCE: adenoviral vector carrying in the genome structure a human lactoferrin gene, administer into an allantois of the 9-10 day chicken embryoses. The subsequent planting is performed by egg incubation at temperature of 37°C within 70-75 hours. Then allocate the recombinant protein from the allantoic liquid of a chicken embryos.

EFFECT: depression of expenses and obtaining simplification of the recombinant human lactoferrin.

FIELD: microbiology.

SUBSTANCE: invention relates to method for production of porphyrinopeptides satisfying the formula I , wherein R1 and R2 independently from one another represent amino acids or peptides comprising 2-15 of amino acid residues, wherein α-carboxylic groups of amino acids or peptides may be modified by C1-C8-alkyl ester and side functional groups of amino acids or peptides may be protected; in particular R1 is ArgOMe; R2 is -OH (III); R1 is LeuHisOMe; R2 is -OH (IV); R1 is LeuLeuValPheOMe; R2 is -OH (V); porphyrin carboxylic group may be modified by methyl or other C1-C9-ester or pharmaceutically acceptable salt; Y- represents Cl-; Me represents Zn, Cu, Fe, Mn. Claimed method includes activation of porphyrin carboxylic group with N-oxy-5-norbornene-2,3-dicarboxyimede in molar ratio of 1:1 in presence of N,N'-dicyclohexylcarbodiinide; or with diphenylphosphorylazide (DPPA) in equimolar ratio of porphyrin/DPPA in presence of base. Then porphyrin with activated carboxylic group is brought into reaction with amino component (amino acid or peptide) in form of mineral acid salt, which is neutralized with base. Also disclosed are methods for application of compounds (I) as nucleotic agents.

EFFECT: new nucleotic agents.

4 cl, 7 ex, 1 tbl

FIELD: chemistry.

SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.

EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.

27 cl, 8 dwg, 21 tbl, 11 ex

FIELD: chemistry.

SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.

EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).

8 cl, 16 dwg, 1 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.

EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.

22 cl, 7 dwg, 2 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: invention refers to biotechnology, specifically to VEGF-A specific binding proteins, and can be used in medicine for treating pathological angiogenesis in mammals. The antiangiogenic protein contains one ankyrin recurrent domain consisting of a N-terminal capping module of ankyrin recurrence, a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GH7EIVEVLLK8GADVNA (SEQ ID NO:5), wherein 1 represents an amino acid residue specified in A, N, R, V, Y, E, H, I, K, L, Q, S and T; 2 is specified in S, A, N, R, D, F, L, P, T and Y; 3 is specified in T, V, S, A, L and F; 4 is specified in W, F and H; 5 is specified in P, I, A, L, S, T, V and Y; 6 is specified in W, F, I, L, T and V; 7 is specified in L or P and 8 is specified in A, H, N and Y; a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GHLEIVEVLLK7GADVNA (SEQ ID NO:1), wherein 1, 2, 3, 4, 5, 6 and 7 independently represents an amino acid residue specified in the group of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y, and a C-terminal capping module.

EFFECT: invention enables producing an antiangiogenic binding VEGF-A165 with Kd less than 10-7 M protein, which inhibits binding VEGF-A165 to VEGFR-2.

12 cl, 4 dwg, 4 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to the field of biotechnology, namely to obtaining oligopeptide compounds, containing a motive, interacting with a proliferating cell nuclear antigen (PCNA) and can be used in medicine. The oligopeptide compound consists of 14-70 amino acids and contains. a PCNA-interacting motive, representing [K/R]-[F/Y/W]-[L/I/V/A]-[L/I/V/A]-[K/R], at least one signal sequence of nuclear localisation and at least one signal sequence of penetration into a cell, with the PCNA-interacting motive being located towards an N-end relative to the signal sequence.

EFFECT: invention makes it possible to carry out the efficient treatment of hyperproliferative disorders by the application of the oligopeptide compound in cyctostatic therapy or in radiotherapy as a sensitising substance.

34 cl, 6 dwg, 4 tbl, 8 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention refers to biotechnology, more specifically to MUC1 cytoplasmic domain peptides, and can be used in the anticancer therapy. A method for inhibiting MUC1-positive cancer cell in an individual involves administering into an individual the MUC1-peptide of the length of at least 6 sequential MUC1 residues and no more than 20 sequential MUC1residues and containing the sequence CQCRRK, wherein the amino terminal cysteine from CQCRRK is closed at its NH2 terminal by at least one amino acid residue, which shall not conform with the native transmembrane sequence MUC-1. Alternatively, there can be used MUC-1 peptide of the length of at least sequential MUC1 residues and no more than 20 sequential MUC1 residues, which contains the sequence CQCRRK with all amino acid residues of the above peptide being D-amino acids.

EFFECT: invention enables inhibiting MUC1oligomerisation effectively and inducing the tumour cell apoptosis and the tumour tissue necrosis in vivo.

80 cl, 16 dwg, 1 tbl, 3 ex

FIELD: metallurgy.

SUBSTANCE: invention relates to casein succinylate of iron (III) wherein iron content varies from 4.5 wt % to 7 wt %, water solubility exceeds 92% while phosphorus-to-nitrogen ratio exceeds 5 wt %.

EFFECT: additionally, invention relates to production of iron (III) and to pharmaceutical composition containing casein succinylate of iron (III).

17 cl, 4 tbl, 9 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: presented group of inventions refers to biotechnology, and concerns a DLK1-Fc fused protein and using it for the metastases inhibition, a polynucleotide coding such a protein, an expression vector containing the polynucleotide, a host cell producing the above fused protein, a method for producing the fused protein by culturing the above host cell, a composition containing the above fused protein, and a method for the metastases inhibition. The characterised fused protein contains a DLK1 extracellular soluble domain consisting of the amino acid sequence SEQ ID NO:4 and Fc domain of a human antibody.

EFFECT: group of inventions can be used for preparing a therapeutic agent for reduction of cancer cell migration and the metastases inhibition.

11 cl, 36 dwg, 3 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention relates to biochemistry. Application of a fused protein to obtain a composition for the body weight reduction is described. The fused protein contains a domain of transduction, a signal of mitochondrial localisation and a domain of a mitochondrial factor of transcription A, binding polynucleotide (TFAM), containing a group with high mobility. Methods of treating obesity by means of the said protein are described.

EFFECT: invention extends an arsenal of means for treating obesity.

9 cl, 5 dwg, 2 ex

FIELD: biotechnology.

SUBSTANCE: invention relates to a method of production of casein calcium chloride of technical casein by precipitation, and can be used in microbiological studies for production of components of storing media of cultures of microorganisms, and also production of calcium co-precipitates for food industry.

EFFECT: improvement of the method.

2 cl, 1 tbl, 5 ex

FIELD: medicine, pharmaceutics.

SUBSTANCE: invention deals with application of composition, which includes hydrolysate of pea protein and/or peptide for obtaining composition for treatment and/or prevention of infection Helicobacter pylori (versions), as well as such compositions (versions). Characterised compositions include lipid, protein and carbohydrate component, in which protein component includes protein source, which consists of pea protein hydrolysate, obtained by hydrolysis with protease, different from chymotrypsin, or from peptides, selected from group, which consists of Xaan-Asp-Phe-Leu-Glu-Asp-Ala-Phe-Asn-Val-Asn-Arg-Xaam and Xaan-Glu-Leu-Ala-Phe-Pro-Gly-Ser-Ala-Gln-Glu-Val-Asp-Arg-Xaam, where each Xaa independently can be any amino acid, and n and m are integer numbers, independently varying from 0-10, where peptide is contained in pea protein hydrolysate, or from both.

EFFECT: claimed inventions make it possible to treat or prevent diseases, caused by Helicobacter pylori infection, and/or diseases, associated with infection Helicobacter pylori in mammals.

17 cl, 2 tbl, 1 ex

FIELD: food industry.

SUBSTANCE: invention relates to a method for manufacture of multiple products from aquatic plant species biomass. Biomass is obtained, destroyed and separated to produce juice and solid phase; the juice is filtered and clarified. Protein is coagulated from the clarified juice to produce broth including a wet protein concentrate. The said concentrate is separated from broth. The wet protein concentrate is dried to obtain dry protein concentrate. The solid phase is used for wet biological raw materials production. The said biological raw materials are dried to produce at least one product selected from among dry biological raw materials and meal rich in carbohydrates. At least 50% of protein in the multiple products is present in dry protein concentration.

EFFECT: method is environmentally friendly and allows production of multiple products selected from among dry biological raw materials and meal rich in carbohydrates.

35 cl, 39 dwg, 7 tbl, 25 ex

FIELD: chemistry.

SUBSTANCE: invention relates to biotechnology of obtaining haemostatic medications. Claimed is method of separating purified fibrinogen concentrate, free of viruses and ballast proteins. Solubilisation of cryoprecipitate of fresh frozen human plasma is realised. Fibrinogen is precipitated with 20-30% PEG solution. Separated sediment is dissolved in buffer with sodium citrate and sodium chloride. Virus inactivation of solution by solvent-detergent method is carried out in presence of 1-3% Tween-80 and 0.1-1.5% of tri-n-butylphoshate. Obtained concentrate is purified from products of virus inactivation and solvent-detergents by triple extraction with liquid paraffin. After that, obtained fibrinogen concentrate is re-precipitated with 1.0-2.5 M glycine solution. Sterile filtration and lyophilic drying with further corking of lyophilisate under vacuum and thermal inactivation are performed.

EFFECT: invention makes it possible to obtained lyophilised form of fibrinogen concentrate with approximately 55% output.

FIELD: biotechnology.

SUBSTANCE: method comprises the steps of destroying the bodies of inclusion, renaturation and purification of protein. Before renaturation, the preliminary purification of protein is carried out using chromatography on Q-Sepharose and SP-Sepharose using the combined columns with Q- and SP-Sepharose. After renaturation chelate and ion-exchange chromatography of recombinant prourokinase M5 is carried out without intermediate elution of the target protein with use of metal-chelate sorbent activated with ions Co2+ or Zn2+.

EFFECT: invention enables to select prourokinase M5 from inclusion bodies, comprising the present prourokinase, with high yield.

4 cl, 2 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: invention relates to the field of obtaining and separation of single-domain molecules (SDAB). Described is a method of the separation or purification of the SDAB molecule, which represents a trivalent molecule of a ATN-103 nanobody, targeting TNFα and HAS, from a mixture, containing the said SDAB molecule and one or more polluting substances. The mixture is brought in contact with a cation-exchange carrier under conditions, which make it possible for the SDAB molecule to bind with the carrier or be absorbed on the carrier. One or more polluting substances are removed and SDAB is selectively eluted from the carrier. The conductivity of a conditioning medium (CM), used for the carrier loading, constitutes from approximately 12 to 9 mS/cm and pH under conditions of loading is corrected to a value from 4.0 to 4.3. The buffer for elution corresponds to approximately 50 mM of sodium chloride or less and has pH from approximately 5.5 to 7.2. Disclosed is a method or a process of obtaining recombinant SDAB of ATN-103. A host-cell is supported in the conditions at which recombinant ATN-103 SDAB is expressed. The mixture of molecule SDAB and one or more polluting substances is obtained. ATN-103 SDAB is purified or separated with the application of cation-exchange chromatography, as said above.

EFFECT: application of the invention provides new methods of the separation or purification of the nanobody, which can be applied in obtaining the ATN-103 nanobody.

19 cl, 4 dwg, 6 ex

FIELD: biotechnologies.

SUBSTANCE: method of obtaining of a complex of antimicrobic peptides of an insect includes infecting of adipose body of an insect at a larval instar with Micrococcus luteus A270 and Escherichia coli D31 bacteria with the subsequent extraction of adipose body of an insect at a larval instar. The adipose body of an insect is placed into a nutrient medium containing water solution of sugars, inorganic salts and the antibiotic meropenem in pre-set ratio and incubated during a day with the subsequent elution of the complex of antimicrobic peptides of an insect from cultural liquid by the method of reverse-phase chromatography on the column Vydac C18 at the linear gradient of acetonitrile from 0% up to 50%.

EFFECT: invention allows to simplify a method of obtaining antimicrobic peptides.

5 dwg, 4 ex

FIELD: chemistry.

SUBSTANCE: invention refers to peptide chemistry and concerns producing tripeptide diacetate H-β-Ala-Pro-DabNHBzl referred to a biologically active compound used in cosmetic industry as an active component for cosmetic products, particularly for stimulating skin rejuvenation, tightening and prevention. The method is based on the 6-staged synthesis and is free from the stages of setting and releasing the protective groups. The method involves proline β-chlorpionyl chloride acylation followed by producing N-(3-chlorpropionyl)proline pentafluorphenyl ester in the presence of N,N'-dicyclohexyl carbodiimide. The above pentafluorphenyl ester is condensed thereafter with glumatic acid monomethyl ester to produce N-(β-chlorpropionyl)-Pro-Glu(δ-OMe)OH. That is followed by benzylamine amidation in a combination with ammonolysis and chlorine substitution by an amino group. That enables producing the tripeptide β-Ala-Pro-Glu(δ-NH2)NHBzl; Hofmann rearrangement is conducted with the use of iodo-benzene diacetate to produce a target product.

EFFECT: method is characterised by simplicity, effectiveness; it is cost-effective and uses more accessible and cheap agents.

6 ex

Up!