Stable compositions containing cationic cellulose polymers and cellulase

FIELD: chemistry.

SUBSTANCE: invention relates to stable liquid compositions which provide good stain removal and colour maintenance. Described are liquid compositions which contain a cationic cellulose polymer and a cellulase enzyme, wherein the liquid compositions contain less than about 20 wt % of water and are encapsulated in a water-soluble or dispersible film.

EFFECT: improved fabric care.

16 cl, 3 tbl, 5 ex

 

The technical field to which the invention relates

The present invention relates to stable, easy to pour, non-aqueous liquid compositions which provide good stain removal and care of color. The present invention also relates to a method of re-mix compositions containing a cellulase composition containing a cationic cellulose polymer.

The level of technology

Currently, consumers want a liquid composition for washing with improved beneficial effects in the care of fabrics, such as improved feeling of fabrics and superior color retention. Cationic cellulose polymers are known in the art to provide beneficial effects in treating tissues, in particular, softness, improved tissue preservation, and therefore, improved fabric care. Cellulose enzymes improve the feel of fabrics and colour by removing the cellulose fibrils from the fiber. Because the beneficial effects of cationic cellulose polymers and cellulase are complementary, there is a strong desire to include them both in a liquid composition for washing. However, the unification of these beneficial effects of the composition of one detergent is extremely problematic because cellulases are known, decompose cationic cellulose polyester�ry. Therefore, liquid compositions, in General, are to avoid combinations of cellulosic polymers and cellulose enzyme. For example, WO2004/056958 describes the sacs containing cationic guar gum in combination with ProcessName and amylase enzymes.

WO 2004/069979 and WO 2007/120547 both describe that inhibitors of enzymes can be used to produce a cationic cellulosic polymers and cellulose enzymes in aqueous detergent compositions. However, such solutions increase the cost and complexity of manufacture. This is due to the cost of an inhibitor of cellulases, but also due to the re-mixing of such compositions in other formulations containing cellulose polymers, leads to the disintegration of the cellulose polymer, as an inhibitor of cellulase diluted to an ineffective level during re-mixing. Even trace amounts of cellulose enzyme, as it has been found to decompose cellulose polymers.

Accordingly, there remains a need for funds for the preparation of liquid compositions with cationic cellulosic polymers and cellulose enzyme, without the collapse of cationic cellulose polymers, or complicating the re-mixing of the product containing cellulose enzyme in a product containing a cellulosic polymer.

Summary of the invention

In accordance with the present invention �predlagaetsja non-aqueous liquid composition, containing: cationic cellulose polymer; and cellulose enzyme; wherein the non-aqueous liquid composition comprises less than 20% by weight of water. The present invention also relates to a method of re-mixing of such non-aqueous liquid compositions, characterized by the fact that this method includes a step of combining non-aqueous composition with another non-aqueous liquid composition containing a polymer based on cellulose.

Detailed description of the invention

The present invention solves the problem of providing a stable composition containing as the cationic cellulosic polymer, and a cellulose enzyme. It was found that by limiting the level of water in the composition, the cellulose activity is inhibited so that it is incapable of decomposing a cationic cellulosic polymer.

If even a trace amount of cellulase present in the aqueous composition, it leads to the disintegration of cellulosic polymers. Therefore, blending of compositions containing cellulose enzyme is either impossible or complicated. This is particularly so because any inhibitors of cellulases, which could be diluted to an ineffective level, if the composition containing cellulase, re-mixed in a fresh composition. By limiting the water level, preferably in re-mixed, and to�echnol compositions the risk of disintegration of the cellulose polymer under the action of cellulose enzyme is eliminated.

All percentages, ratios and proportions used in this application are mass percent non-aqueous liquid composition. When talking about the products of the standard dose, all percentages, ratios and proportions used in this application, are by mass percent of the content branch of the standard dose. That is, excluding the mass of encapsulating material. For products standard doses with multiple compartments, percentages, ratios and proportions used in this application are mass percent content of the individual branch of the standard dose, unless otherwise indicated.

Non-aqueous liquid composition

As used in this application, "non-aqueous liquid composition" refers to any liquid composition containing less than 20%, preferably less than 15%, more preferably less than 12%, most preferably less than 8% by weight of water. For example, with no additional water in addition to that which is captured other parts of the ingredients. The term "liquid" also includes viscous forms, such as gels and pastes. Non-aqueous liquid may contain other solids or gases subdivided into an acceptable form, but excludes f�PMS, which are not liquid in General, such as tablets or granules.

Non-aqueous composition according to the present invention may also contain from 2% to 40%, more preferably from 5% to 25% by mass of the nonaqueous solvent. As used in this application, "non-aqueous solvent" refers to any organic solvent that does not contain any amidofunctional groups. Preferred non-aqueous solvents include Monohydric alcohols, dihydric alcohols, polyhydric alcohols, glycerol, glycols including polyalkylene glycols such as polyethylene glycol, and mixtures thereof. More preferred non-aqueous solvents include Monohydric alcohols, dihydric alcohols, polyhydric alcohols, glycerol and mixtures thereof. Highly preferred are mixtures of solvents, especially mixtures of two or more of the following: lower aliphatic alcohols such as ethanol, propanol, butanol, isopropanol; diols such as 1,2-PROPANEDIOL or 1,3-PROPANEDIOL and glycerol. Also preferred are propandiol and its mixture with diethylene glycol, wherein the mixture does not contain methanol or ethanol. Thus, the implementation of the non-aqueous liquid compositions according to the present invention may include the implementation using propandiol, but methanol and ethanol are not used.

Preferred Neuve�derivative solvents are liquid at ambient temperature and pressure (i.e. 21°C and 1 atmosphere), and contain carbon, hydrogen and oxygen. Non-aqueous solvents can be present in the preparation of the premix, or at the end of the nonaqueous composition.

Cationic cellulose polymer

Non-aqueous liquid composition according to the present invention can contain from 0.01% to 20%, preferably from 0.1% to 15%, more preferably from 0.6% to 10% by weight of a cationic cellulosic polymer.

Cationic cellulose polymer preferably has a cationic charge density of from 0.005 to 23, more preferably from 0.01 to 12, most preferably from 0.1 to 7 milliequivalent/g, at pH non-aqueous liquid composition. The charge density is calculated by dividing the total number of charges in a recurring segment on the molecular weight of the repetitive unit. Positive charges can be located on the frame of the polymers and/or side chains of polymers. The term "cationic cellulosic polymer" also includes amphoteric cellulosic polymers that have a total positive charge at a pH of non-aqueous liquid composition.

Acceptable cationic cellulose polymers include the cationic hydroxyethyl cellulose and cationic hydroxypropyl cellulose. Preferred cationic cellulose for use in this application include those that may or may not be hydrophobically modified,including those which have a hydrophobic group of substituents having a molecular weight from 50000 to 2000000, more preferably from 100,000 to 1,000,000 and most preferably from 200000 to 800000. These cationic cellulose polymers have repeating substituted anhydroglucose links that correspond to the General structural formula I, below:

where:

a. m means an integer from 20 to 10,000

b. each R represents H, and R1, R2, R3each independently selected from the group consisting of: H; C1-C32alkyl; C1-C32substituted alkyl, C5-C32or C5-C32aryl, C5-C32or C6-C32substituted aryl or C6-C32alkylaryl, or C6-C32substituted alkylaryl, and. Preferably, R1, R2, R3each independently selected from the group consisting of: H; and C1-C4alkyl;

where:

n means an integer selected from 0 to 10, and Rx is selected from the group consisting of: R5;

where at least one Rx in the specified polysaccharide has a structure selected from the group consisting of:,

where And-is an acceptable anion. Preferably, A-selected from the group consisting of Cl -, Br-, I-, methylsulfate, ethyl sulfate, toluene sulfonate, carboxylate and phosphate;

Z is selected from the group consisting of carboxylate, phosphate, phosphonate and sulphate;

q is an integer selected from 1 to 4;

each R5independently selected from the group consisting of: H; C1-C32alkyl; C1-C32substituted alkyl, C5-C32or C3-C32aryl, C5-C32or C6-C32substituted aryl, C6-C32alkylaryl, C6-C32substituted alkylaryl and HE. Preferably, each of R5selected from the group consisting of: H, C1-C32the alkyl and C1-C32substituted alkyl. More preferably, R5selected from the group consisting of H, methyl and ethyl.

Each R6independently selected from the group consisting of: H, C1-C32alkyl, C1-C32substituted alkyl, C5-C32or C6-C32aryl, C5-C32or C6-C32substituted aryl, C6-C32alkylaryl, and C6-C32substituted alkylaryl. Preferably, each of R6selected from the group consisting of: H, C1-C32the alkyl and C1-C32substituted alkyl.

Each T is independently selected from the group: H,

where each v in the specified polysaccharide STP�denotes an integer from 1 to 10. Preferably, v indicates an integer from 1 to 5. The sum of all indices v in each Rx in the specified polysaccharide means an integer from 1 to 30, more preferably from 1 to 20, even more preferably from 1 to 10. In recent

the group in chain T always represents N. Alkyl substitution on anhydroglucose cycles of the polymer may range from 0.01% to 5% per glucose unit, more preferably from 0.05% to 2% on the glucose level of the polymer material. Cationic cellulose may be a small degree of transverse cross-linked with a dialdehyde, such as glyoxal to prevent the formation of lumps, nodules or other agglomerations when added to water at ambient temperatures. Cationic cellulose ethers of the structural formula I also include those that are commercially available and include materials that can be obtained by traditional chemical modification of commercially available materials. Commercially available cellulose ethers of the type of structural formula I include having the INCI name Polyquaternium 10, such as those sold under the trademarks: Ucare Polymer JR 30M, JR 400, JR 125, LR 400 and LK 400 polymers; Polyquaternium 67 such as those sold under the trade name Softcat SK™, all of which are sold Amerchol Corporation, Edgewater NJ; and Polyquaternium 4 such as those sold under the trade Mar�Oh: Celquat N and Celquat L-200, available from National Starch and Chemical Company, Bridgewater, NJ. Other suitable polysaccharides include hydroxyethyl cellulose or hydroxypropyl cellulose, quaternion glycidyl C12-C22alkyl of dimethylammonium chloride. Examples of such polysaccharides include polymers with the INCI names Polyquaternium 24, such as those sold under the trade name Quaternium LM 200 by Amerchol Corporation, Edgewater NJ.

Cationic cellulosic polymer can be modified to become more resistant to disintegration under the action of cellulose enzyme. For example, it was found that reducing the number of unsubstituted anhydroglucose links yields a cationic cellulosic polymer, is less sensitive to enzymatic degradation. It is believed that this is caused by the breakage of a chain enzyme, occurring mainly between adjacent unsubstituted anhydroglucose links. Thus, cationic cellulose polymers, including cationic hydroxyethyl cellulose and cationic hydroxypropyl cellulose having a high degree of molar substitution, as has been found, are more resistant to disintegration under the action of cellulose enzymes.

Molar substitution is the average number of substitutions on anhydroglucose duplicate link in the cellulose skeleton. Likewise, cationic hydroxyethyl and hydrox�of proposalwas, molar ratio is the average number of moles ethylene oxide and/or propylene oxide, are reacted with each anhydroglucose duplicate link in the cellulose skeleton. Each repeating unit has three hydroxyl groups available for reaction with ethylene oxide or propylene oxide. However, the resulting hydroxyethylene/hydroxyproline groups also have a hydroxyl group available for further reaction with ethylene oxide or propylene oxide. Therefore, the molar substitution can be above 3.

Cationic cellulose, including cationic hydroxyethyl cellulose and hydroxypropyl cellulose having a degree of substitution of more than 1.34, the also exhibit increased resistance to disintegration under the action of cellulose enzyme. The degree of substitution is the average number of hydroxyl groups anhydroglucose repeating unit in the cellulose skeleton with substitution. Therefore, the degree of substitution can be a maximum of 3 for cationic cellulosic polymer. Reduced compactness in the same way as has been found, reduces enzymatic degradation. The compactness of the cationic cellulosic polymer is heterogeneously substituted cationic cellulose polymer. For example, cationic hydroxyethyl or hydroxypropylcellulose, how Cam�Lena heterogeneity, are hydroxyethylene and/or hydroxyproline groups along the cellulose skeleton. Believe that the increased compactness increases the number of consecutive unsubstituted anhydroglucose repeating units available to attack cellulose enzyme. A measure of this heterogeneity is the ratio of unsubstituted trimers (U3R): the ratio of unsubstituted anhydroglucose trimmers and most often substituted anhydroglucose trimers. U3R is calculated using the method of mass spectrometry as described in US 2006/0182703 A1 (page 4, paragraphs 48-56). For cationic hydroxyethyl and hydroxypropylcellulose, hydroxyethylene and/or hydroxyproline molar substitution is preferably from 1.3 to 5, and the ratio of unsubstituted anhydroglucose trimmers and most often substituted anhydroglucose of trimers is preferably less than 0,235, more preferably less than 0,21.

Resistance to disintegration under the action of cellulose enzyme can also be strengthened by increasing the substitution at the C2 position in anhydroglucose duplicate link. The distribution of the substituents at C2, C3 and C6 positions in anhydroglucose repeating the link for cationic cellulose polymers, such as cationic hydroxyethyl cellulose, cationic hydroxypropyl cellulose and their produ�nye, can be measured by the method of Lindberg described in Carbohydrate Research, 170 (1987) 207-214. These polymers contain eight types anhydroglucose repeating units, in terms of the number and location of substituents, abbreviated called SO, S2, S3, S6, S23, S26, S36 and S236. They are defined as S0 - unsubstituted anhydroglucose links; S2, S3, S6-anhydroglucose links with one substituent in the C2, C3 and C6, respectively; S23, S26, S36 - anhydroglucose links with two substituents numbered in the regulations; S236 - anhydroglucose links with all three of the replaced provisions. Since C3 relative to directionspoint, the measure increased substitution at the C2 position is given using the percentage of C2-substituted trimers (i.e. the sum of S2, S23, S26, S236) relative to the percentage of C6-substituted trimers (sum of S6, S26, S36, S236). To improve enzyme stability by using a favourable substitution in C2, with the percentage of C2-substituted trimers is preferably more than 0.8 times, more preferably more than 0.9 times, the percentage of C6-substituted trimers.

To further reduce any decay under the action of a cellulose enzyme, non-aqueous liquid composition may contain a cationic cellulosic polymer in the form of particles. That is, cationic cellulose�th polymer is insoluble in non-aqueous liquid composition, or not fully soluble in non-aqueous liquid composition. Acceptable forms include solid particles of a substance which completely do not contain water and/or another solvent, but also include solids that are partially hydrated and/or solvated. Partially hydrated or solvated particles are those which contain water and/or other solvent at levels that are insufficient to cause complete solubilization particles. A useful property of partial hydration and/or solvation of cationic cellulosic polymer is that in any form agglomerates have a low strength of the filter cake and is easily re-dispersed. Such hydrated or solvated particles in General contain from 0.5% to 50%, preferably from 1% to 20% of water or solvent. While water is preferred, any solvent capable of partial solvation of cationic cellulosic polymer, may be used. The particles of the cationic cellulosic polymer is preferably as small as possible. Acceptable particles have an average diameter square D90 less than 300 microns, preferably less than 200 microns, more preferably less than 150 microns. The average diameter of the square D90 is defined as 90% of the particles having a size less than the square cu�ha having a diameter D90. Method of measuring particle sizes are given in the section Test methods.

Cellulose enzyme

For beneficial effects the feel of fabrics and care of color, non-aqueous liquid composition may contain from 0,000005% to 0.2%, preferably from 0.00001 to 0.05%, more preferably from 0.0001% to 0.02% by weight of cellulose enzyme. However, cationic cellulose polymers, it has been found that disintegrate even at residual levels of cellulose enzyme in aqueous compositions. In fact, non-aqueous liquid composition according to the present invention, as has been found to provide a useful effect on the levels of cellulose enzyme, at least 0,0000046% by weight. Even at such a low level of cellulose enzyme, it has been found that decomposes cationic cellulose polymers in aqueous compositions.

Acceptable cellulases include endo-beta-1,4-glucanase,

cellobiohydrolase and beta-1,4-glucosidase, bacterial or fungal origin, from any of the family of glycoside hydrolases, showing cellulose activity. Included are chemically modified or designed by a method of protein engineering mutants. Acceptable cellulases include cellulases genera Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, e.g. the fungal cellulases produced from Humicola insolens, Myceliophthora thermophila and Fusarium oxysporum described US 4,435,307, US 5,648,263, US 5,691,178, US 5,776,757 and WO 89/09259.

Particularly acceptable cellulases are the alkaline or neutral cellulases having useful effects care color. Examples of such cellulases are cellulases described in EP 0 495 257, EP 0 531 372, WO 96/11262, WO 96/29397, WO 98/08940. Other examples include cellulose options, for example, described in WO 94/07998, EP 0531315, US 5,457,046, US 5,686,593, US 5,763,254, WO 95/24471 and WO 98/12307.

Commercially available cellulases include Celluzyme®, and Carezyme® (Novozymes A/S), Clazinase®, and Puradax® EG-L and Puradax® HA (Genencor International Inc.) and KAC®-500(B) (Kao Corporation).

In one aspect, the cellulase may include endoglucanase of microbial origin, exhibiting endo-beta-1,4-glucanase activity (E. C. 3.2.1.4), including a bacterial polypeptide endogenous to a member of the genus Bacillus which has a sequence at least 90%, 94%, 97% and even 99% identity to the amino acid sequence SEQ ID NO:2 in US 7,141,403 and mixtures thereof. Acceptable endoglucanase sold under the trademarks Celluclean® and Whitezyme® (Novozymes A/S, Bagsvaerd, Denmark).

Preferably, the composition comprises a cleaning cellulase belonging to family helicoiling hydrolases 45 having a molecular weight of from 17 kDa to 30 kDa, for example endoglucanase, which are sold under the brand Biotouch® NCD, DCC and DCL (AB Enzymes, Darmstadt, Germany). Cellulase may be intentionally formulated, or it may be introduced into the detergent composition CP�of DSTV as an impurity in other raw materials, especially the enzyme. Commercial of many classes of enzymes, such as protease, alpha-amylase, beta-mannanase, pectate lyase and lipase, may comprise additional cellulase activity production of microorganisms expressing cellulose enzymes that are not completely removed during the purification stages, or through contamination from other products during the production process enzymes. Commercial protease Purafect® Prime (Genencor Division, Danisco) is an example recalulate enzyme, which typically contains a considerable admixture of cellulase.

Another source of unintentional presence of cellulase in the detergent compositions is from cross-contamination in industrial plants, for example, changing tsellyulozosoderzhashchimi of tracks that do not contain intentionally drafted in the cellulase composition.

Additives for Laundry

Non-aqueous liquid composition according to the present invention may contain traditional detergent ingredients for washing selected from the group consisting of anionic and nonionic surfactants; additional surfactants; other enzymes; enzyme stabilizers; cleaning of polymers, including: amphiphilic alkoxysilane polymers, purifying the fat, polymers, cleansing clay� pollution, polymers which release pollution and polymers, suspendresume pollution; bleaching systems; optical brighteners; coloring dyes; material in the form of particles; perfume and other odour control; hydrotropes; foam suppressors; agents useful for the care of fabrics; agents that regulate pH; agents inhibiting dye transfer; preservatives; direct dyes are not for fabrics and their blends. Some of the optional ingredients that can be used are described in more detail as follows.

Anionic and non-ionic surfactants

Non-aqueous liquid composition according to the present invention can contain from 1% to 70%, preferably from 10% to 50%, and more preferably from 15% to 45% by weight of anionic and/or nonionic surfactants.

Non-aqueous liquid composition according to the present invention preferably contain from 1 to 70%, more preferably from 5 to 50% by weight of one or more anionic surfactants. Preferred anionic surface-active agent selected from the group consisting of: C11-C18 alkylbenzene sulfonates, C10-C20 of alkylsulfates branched chain and random alkylsulfates, C10-C18 alkyl ethoxy sulfates, branched in the middle of the chain alkylsulfates,�evennig in the middle of the chain alkyl alkoxy sulfates, C10-C18 alkyl alkoxy carboxylates containing 1-5 ethoxy units, modified alkylbenzene sulfonate, C12-C20 sulfonate complex methyl ester, C10-C18 alpha-olefin sulfonate, C6-C20 of sulfosuccinates and mixtures thereof. However, by nature, every anionic surfactant known in the field of detergent compositions may be used, for example, described in "Surfactant Science Series", Vol.7, edited by W. M. Linfield, Marcel Dekker. However, compositions in accordance with the present invention preferably contain at least one surfactant based on sulfonic acid, such as linear alkyl benzene sulfonic acid, or water soluble salt form.

Anionic sulfonate surfactants or surface-active substances on the basis of the sulfonic acids suitable for use in this application include the acid and salt forms of linear or branched C5-C20, more preferably C10-C16, most preferably SP-C alkylbenzene sulfonates, C5-C20 of esters alkyl sulphonates, C6-C22 primary or secondary alkanesulfonyl, C5-C20 sulfonated polycarboxylic acids, and mixtures thereof. The above surfactants can vary widely on the content of 2-phenyl isomer. Anionic sulphate salts, when�mimie for use in the compositions according to the present invention include: primary and secondary alkylsulfate, having a linear or branched alkyl or alkenyl fragment having from 9 to 22 carbon atoms, more preferably 12 to 18 carbon atoms; beta-branched alkylsulfate surfactants, and mixtures thereof. Branched in mid-chain alkyl sulphates or sulfonates are also acceptable anionic surfactants for use in compositions in accordance with the present invention. Preferred are C5-C22, preferably C10-C20 branched in the middle of the chain primary alkyl sulfates. If a mixture, an acceptable average total number of carbon atoms in the alkyl fragments is preferably in the range from 14.5 to 17.5. Preferred mono-methyl branched primary alkylsulfates selected from the group consisting of 3-methoxy - 13-methyl pentadecanol sulfates corresponding to hexadecanol sulfates, and mixtures thereof. Dimethylene derivatives or other biodegradable alkyl sulphates, having a light branching, can be used in a similar way. Other suitable anionic surfactants for use in this application include fatty methyl ester sulfonates and/or alkyl ethoxy sulfates (AES) and/or alkyl polyalkoxysiloxanes the carboxylates (AEC). Mixtures of anionic surface�STN-active substances can be used, for example, a mixture of alkylbenzene sulfonates and AES.

Anionic surfactants are typically present in the form of their salts with alkanolamines or alkali metals such as sodium and potassium. Preferably, the anionic surfactant is neutralized with alkanolamines such as monoethanolamine or triethanolamine, and they are completely soluble in non-aqueous liquid composition.

Non-aqueous liquid composition according to the present invention can contain from 1 to 70%, preferably from 5 to 50% by weight nonionic surfactant. Acceptable non-ionic surfactants include, but are not limited to shows, C12-C18, alkylalkoxysilane ("AE") including the so-called alkylalkoxysilane with narrow peaks, C6-C12 an alkylphenol alkoxylate (especially ethoxylate and mixed ethoxylate/propoxylate), block acceleratedly condensate of C6-C12 alkyl phenols, alkilinity condensates C8-C22 of alkanols and block polymers of ethylene oxide/propylene oxide (Pluronic®, BASF Corp.), and propolene non-ionic substances (e.g., aminoxide and phosphine oxides). Broad disclosure of acceptable non-ionic surfactants can be found in U.S. patent No. 3929678.

Alkylpolyglucoside, such as those described in U.S. patent No. 4565647, are also useful nonionic surface-activemessage in the compositions according to the present invention. Also acceptable are alkyl polyglucoside surfactants. In some realizations acceptable non-ionic surfactants include nonionic surfactants of the formula R1(OC2H4)nOH, where R1 is a C10-C16 alkyl group or a C8-C12 alkyl phenyl group and n is from 3 to 80. In some realizations of non-ionic surfactants may be the condensation products of C12-C15 alcohols with from 5 to 20 mol of ethylene oxide per mole of alcohol, e.g., C12-C13 alcohol condensed with 6.5 moles ethylene oxide per mole of alcohol. Additional acceptable non-ionic surfactants include amides of polyhydroxy fatty acids of the formula:

,

where R is a C9-C17 alkyl or alkenyl, R1 is a methyl group and Z represents glycidyl obtained from the recovered sugar or alkoxysilanes derived. Examples are N-methyl N-1-desoxyglucose cocoamide and N-methyl N-1-desoxyglucose oleamide.

Additional surfactants

Non-aqueous liquid composition according to the present invention may comprise additional surfactant selected from the group consisting of: anionic, cationic, neon�'s, amphoteric and/or zwitterionic surfactants and mixtures thereof.

Acceptable cationic surfactants can be water-soluble, dispersible in water or insoluble in water. Such cationic surfactants contain at least one quaternionic a nitrogen atom and at least one long-chain gidrolabilna group. Also included are compounds containing two, three or four long-chain gidrolabilna group. Examples include alkyltrimethylammonium salts, such as C12, alkyltrimethylammonium chloride, or hydroxyacetaldehyde counterparts. The present invention may contain 1% or more of cationic surfactants.

Amphoteric detergent surfactants that are acceptable for use in the composition include surfactants, broadly described as derivatives of aliphatic secondary and tertiary amines in which the aliphatic radical can be straight or branched chain, and wherein one of the aliphatic substituents contains from 8 to 18 carbon atoms and one contains an anionic group such as carboxy, sulfonate, sulfate, phosphate or phosphonate. Acceptable amphoteric detergent surfactants for use in the present invention, including�up, but not limited to the above: cocoamphoacetate, cocoamphodiacetate, lauroamphoacetate, lauroamphodiacetate and mixtures thereof.

Zwitterionic detergent surfactants suitable for use in non-aqueous liquid compositions are well known in the art and include surfactants, broadly described as derivatives of aliphatic Quaternary ammonium compounds, phosphonium and sulfone in which the aliphatic radicals can be straight or branched chain and wherein one of the aliphatic substituents contains from 8 to 18 carbon atoms and one contains an anionic group such as carboxy, sulfonate, sulfate, phosphate or phosphonate. Zwitterionic substances, such as betaine are also acceptable for the present invention. Additionally, aminoxide surfactants having the formula: R(EO)x(PO)y(BO)zN(O)(CH2R')2·qH2Oh, also useful in the compositions according to the present invention. R is a relatively long-chain hydrocarbonyl fragment, which may be saturated or unsaturated, linear or branched and can contain from 8 to 20, preferably from 10 to 16 carbon atoms, and is more preferably C12-C16 primary alkyl. R' represents �Wallpaper short-chain fragment, preferably selected from hydrogen, methyl and-CH2OH. If x+y+z is different from 0, EO is ethyleneoxy, RO is propionoxy and is IN butylenes. Aminoxide surfactants are illustrated by C12-C14 alkyldimethyl aminoxide.

Non-limiting examples of other anionic, zwitterionic, amphoteric or optional additional surfactants suitable for use in the compositions described in McCutcheon's, Emulsifiers and Detergents, 1989 Annual, published by M. C. Publishing Co., and in the U.S. patents№№3,929,678, 2,658,072; 2,438,091; 2,528,378.

Other enzymes

Non-aqueous liquid composition according to the present invention may contain from 0.0001% to 8% by weight of other detergent enzymes which provide enhanced cleaning efficiency and/or useful effects when taking care of fabrics. Such compositions preferably have a pH of the composition is from 6 to 10.5. Acceptable enzymes can be selected from the group consisting of: lipase, protease, amylase, mannanase, pectate lyase, xyloglucans and their mixtures, in addition to the cellulose enzyme. The preferred combination of enzymes includes a cocktail of traditional detergent enzymes, such as lipase, protease and amylase. Detergent enzymes are described in greater detail in U.S. patent No. 6579839.

The stabilizers of enzymes

Enzymes can be stable�analyzed using any known system stabilizers, such as compounds of calcium and/or magnesium, boron compounds and substituted boric acids, aromatic borate esters, peptides and peptide derivatives, polyols, low molecular weight carboxylates, relatively hydrophobic organic compounds [e.g. certain esters, diacylglyceride ethers, alcohols or alcohol alkoxylates], alkyl ether carboxylate in addition to the source of calcium ions, hypochlorite of benzamidine, lower aliphatic alcohols and carboxylic acids, N,N-bis(carboxymethyl) serine salts; a copolymer of (meth)acrylic acid ester (meth)acrylic acid and PEG; the connection of lignin, a polyamide oligomer, glycolic acid or its salts; polyhexamethylene of biguanide or N,N-bis-3-amino-propyl-dodecyl amine or salt; and mixtures thereof. Can be used any acceptable inhibitor of cellulases. Examples of inhibitors of cellulases are listed in N. Zolter, Handbook of Enzyme Inhibitors, 3ed, Part A, pp.307-309. Such inhibitors of cellulases preferably present at a level from 0.0001% to 3% by mass of the nonaqueous composition.

Useful agents for fabric care

Non-aqueous composition may further contain from 1% to 15%, more preferably from 2% to 7% by weight beneficial agent for textile care, in addition to the cationic cellulose polymer and cellulose enzyme. "A useful agent for fabric care", �AK used in this application, refers to any material that can provide beneficial effects when taking care of cloth. Non-limiting examples of beneficial effects in the fabric care products include, but are not limited to: fabric softening, color protection, color restoration, reduction of stall/sushimania, antihistimine and antimiani. Non-limiting examples of useful agents for fabric care products include: silicone derivatives, such as polydimethylsiloxane and amino-functional silicones; oily sugar derivatives; water-dispersible polyolefins; polymer latexes; cationic surfactants, and combinations thereof.

Cleaning polymers

Non-aqueous liquid compositions in this application may contain from 0.01% to 10%, preferably from 0.05% to 5%, more preferably from 0.1% to 2.0% by weight of the cleaning polymers that provide a wide range of cleaning surfaces and fabrics from contamination. Can be used any acceptable cleaning polymer. Useful cleaning polymers described in US 2009/A. Non-limiting examples of useful categories cleaning polymers include: amphiphilic alkoxysilane polymers, cleansing fat; polymers, cleansing clay pollution; polymers which release pollution and polymers, suspendresume pollution. Other anionic polymers, useful for improving clean�Ki from contamination, include: silicone polymers of natural origin and of synthetic origin. Acceptable anion that does not contain silicone polymers can be selected from the group consisting of xanthan gums, anionic starches, carboxymethylate, karboksimetoksimetilguanina, carboxymethyl cellulose and modified esters of carboxymethyl cellulose, N-carboxyaniline, N-carboxymethylchitin amides, pectin, carraginanous gum, chondroitin sulfate, water-soluble, polymers, hyaluronic acid and alginic acid and their derivatives and their mixtures. More preferably, anionic, containing silicone polymer can be selected from carboxymethylate, karboksimetoksimetilguanina, carboxymethylcellulose and xanthan gums, and their derivatives and their mixtures. Preferred anionic, silicone polymers include commercially available from CPKelco, sold under the trademark Kelzan® RD and from Aqualon, sold under the trademark Galactosol® SP722S, Galactosol® 60H3FD and Galactosol® 70H4FD.

Optical brighteners

They are also known as fluorescent whitening agents for textiles. Preferred levels are from 0.001% to 2% by weight non-aqueous liquid composition. Acceptable bleaching agents described in EP 686691 IN and include both hydrophobic and hydro�ilen types. Bleach 49 is preferred for use in the present invention.

Temporary colours

Temporary colours or shading dyes for tissue are useful additives for washing in non-aqueous liquid compositions. Acceptable dyes include blue and/or violet dyes having coloring or shading effect. See, for example, WO 2009/087524 A1, WO 2009/087034A1 and the references cited therein. Recent developments, which are acceptable for the present invention include sulfonated phthalocyanine dyes containing a Central atom of zinc or aluminum. Non-aqueous liquid compositions in this application can contain from 0,00003% to 0.1%, preferably from 0.00008 inch%) to 0.05% by weight coloring dye for cloth.

Material in the form of particles

Non-aqueous composition may contain additional material in the form of particles, such as clay, foam suppressors, encapsulated sensitive to oxidation and/or thermally sensitive ingredients such as perfumes (microcapsules perfumes, brighteners and enzymes, or aesthetic additives such as pearlescent agents, including mica, pigment particles, or the like. Acceptable levels comprise from 0.0001% to 10% or from 0.1% to 5% by mass of the nonaqueous composition.

Perfume and other agents of odor control

In the pre�occhialini the implementation of non-aqueous composition comprises free and/or microencapsulated odorant. If present, free perfume, typically included at a level from 0.001% to 10%, preferably from 0.01% to 5%, more preferably from 0.1% to 3% by mass of the nonaqueous composition.

If present, the perfume microcapsule is formed at least partially surrounding the raw material fragrance material of the walls. Preferably, the wall material of the microcapsules contains: melamine, cross stitched with formaldehyde, polyurea, urea, transversely crosslinked with formaldehyde, or urea, a transversely cross-linked with glutaric aldehyde. Acceptable perfume microcapsules and nanocapsules odorants include are described in the following references: US 2003215417 A1; US 2003216488 Al; US 2003158344 Al; US 2003165692 Al; US 2004071742 Al; US 2004071746 Al; US 2004072719 Al; US 2004072720 Al; EP 1393706 Al; US 2003203829 Al; US 2003195133 Al; US 2004087477 Al; US 20040106536 Al; US 6645479; US 6200949; US 4882220; US 4917920; US 4514461; US RE 32713; US 4234627.

In other realizations, non-aqueous composition comprises agents, odour control, such as unrelated to the complex of cyclodextrin, as described in US 5942217.

Other acceptable agents odour control include are described in: US 5968404, US 5955093, US 6106738, US 5942217 and US 6033679.

Hydrotropic

Non-aqueous liquid composition according to the present invention typically contains hydrotap in an effective amount, preferably up to 15%, more preferably from 1% to 10%, most preferably from 3% to 6% by weight so that the composition is easy var�Giroud in the water. Acceptable hydrotropic for use in this application include hydrotropic anionic type, in particular, sodium, potassium, and ammonium xylene sulfonate, sodium, potassium and ammonium toluensulfonate, sodium, potassium and ammonium cumene sulfonate, and mixtures thereof, as described in US 3915903.

Polyvalent water-soluble organic strukturoobrazovatelja and/or chelating agent

Non-aqueous liquid composition according to the present invention can win from 0.6% to 25%, preferably from 1% to 20%, more preferably from 2% to 7% by weight water-soluble polyvalent organic structuring agent and/or chelating agents. Water-soluble organic amendments provide a wide range of benefits, including the absorption of calcium and magnesium (improved cleaning in hard water), ensuring alkalinity, complexation of transition metal ions, stabilization of colloidal metal oxides and providing a substantial surface charge for peptization and suspending other contaminants. Hepatoblastoma agents can selectively bind transition metals (e.g., iron, copper and manganese), which has an impact on the removal of stains and stability of whitening ingredients, such as organic bleach catalysts, in the washing solution. Preferably, watering�turbulent water-soluble organic strukturoobrazovatelja and/or hepatoblastoma agents in accordance with the present invention, selected from the group consisting of: MEA citrate, citric acid, aminoalkylindole(alkylenediamines), alkali metal ethane 1-hydroxyifosfamide, and nitrilotriethanol, phosphonates, Diethylenetriamine Penta(methylenephosphonic acid) (DTPMP), Ethylenediamine Tetra(methylenephosphonic acid) (DDTMP), hexamethylenediamine Tetra(methylenephosphonic acid), hydroxyethylene the 1,1 diphosphonic acid (HEDP), hydroxyethane dimethylethanol acid, Ethylenediamine dinternal acid (EDDS), ethylenediaminetetraacetic acid (EDTA), hydroxyethylammonium triacetate (HEDTA), nitrilotriacetate (NTA), methylpyridazine (MGDA), iminodisuccinate (IDS), hydroxyethylmethacrylate (HIDS), hydroxyethylmethacrylate (HEIDA), glycine diacetate (GLDA), Diethylenetriamine pentauksusnoi acid (DTPA) and their mixtures.

External structuring system

Non-aqueous liquid composition may also contain an external structurant. External structuring system is a compound or mixture of compounds that provide either sufficient fluidity or low shear viscosity to stabilize the non-aqueous liquid compositions, regardless or externally, from a structuring influence of any detergent surfactants in the composition. Non-aqueous liquid composition may contain from 0.01% to 10%, preferably from 0.1% to 4% �on the weight of the external structuring system. Acceptable external structuring systems include polimernye crystal, hydroxyquinoline structure, polymer structure-forming agent or a mixture thereof.

Preferably, the external structuring system imparts high shear viscosity at 20-1at 21°C, from 1 to 1500 CPS and a viscosity at low shear (0.05 s-1at 21°C) more than 5000 SP. The viscosity is measured with a rheometer AR 550, from TA instruments, using the spindle is made of steel plate with a diameter of 40 mm and a gap of 500 μm. The high shear viscosity at 20-1and low shear viscosity at 0.5 s-1can be obtained from a logarithmic sweep shear rate from 0.1 s-1to 25-1after 3 minutes at 21°C.

External structuring system may contain polimerny crystalline, hydroxyl functional structurant. Such polimernye crystalline, hydroxyl functional

amendments, as a rule, contain crystallizing the glycerides, which may be pre-emulsified to facilitate dispersion in the final non-aqueous composition. Preferred crystallized glycerides include hydrogenated castor oil or "VAT", and its derivatives, provided that they are able to crystallize in non-aqueous composition. Other� implementation of acceptable external structuring systems may include received by natural and/or synthetic polymeric structurant. Examples of acceptable obtained by natural polymer structure-forming agents include hydroxyethylcellulose, hydrophobically modified hydroxyethylcellulose, carboxymethylcellulose, derivatives of polysaccharides, and mixtures thereof. Acceptable derivatives of polysaccharides include pectin, alginate, arabinogalactan (gum Arabic), carrageenan, Galanova gum, xanthan gum, guar gum and mixtures thereof. Examples of acceptable synthetic polymer amendments include: polycarboxylates, polyacrylates, hydrophobically modified ethoxylated urethanes, hydrophobically modified nonionic polyols and mixtures thereof. The product standard dose

Non-aqueous liquid composition according to the present invention can accommodate products in standard doses containing at least one fluid-filled compartment. The fluid-filled compartment relates to the separation of the product standard dose containing a liquid capable of wetting the fabric, like clothing. These products are standard dose contain in one, easy to use dosage form: cationic cellulose polymer and cellulose enzyme contained in the nonaqueous compositions encapsulated in a water soluble or dispersible film.

The product standard doses may be of any type, FD�we and material, that was acceptable to hold the non-aqueous compositions, i.e. not allowing the release of non-aqueous composition, and any additional component, from the product of the standard dose before contact products standard dose of water. The exact execution will depend on such factors as the type and number of tracks in the product standard dose and number of offices in the product standard doses, and the characteristics required of a product standard doses are kept, protect and deliver or release the compositions or components.

The product standard dose contains water-soluble or water-dispersible film, which completely covers the at least one internal volume containing a non-aqueous composition. The product standard doses may not necessarily contain extra compartments containing non-aqueous liquid and/or solid components. Alternatively, any additional solid component can be suspended in a fluid-filled compartment. Standard dosage form with multiple compartments may be desirable for reasons such as: the separation of chemically incompatible ingredients; or if it is desirable that the proportion of ingredients was released in the wash sooner or later.

It may be preferable to any branch that contains the liquid component, also �won air bubble. Air bubble may have a volume less than 50%, preferably less than 40%, more preferably less than 30%, more preferably less than 20%, most preferably less than 10% of the amount of space specified office. Without being bound by theory, believe that the presence of the air bubble increases the portability of the product standard dose to the movement of the liquid component within the compartment, thereby reducing the risk of leakage of the liquid component from the separation.

Water-soluble or water-dispersible film

Water-soluble or water-dispersible film typically has a solubility of at least 50%, preferably at least 75%, more preferably at least 95%. Method of determining the water solubility of the film is given in the Test methods section. Water-soluble or water-dispersible film typically has a time for dissolution in less than 100 seconds, preferably less than 85 seconds, more preferably less than 75 seconds, most preferably less than 60 seconds. The method of determination of time of dissolution of the film, see Test methods.

The preferred films are polymeric materials, preferably polymers which are formed into film or sheet. The film can be obtained by casting, blow molding, extrusion or extrusion with subsequent rasuwa� polymeric material, as is known in the art. Preferably, water-soluble or dispersible film comprises: polymers, copolymers or their derivatives, including polyvinyl alcohols (PVA), polyvinylpyrrolidone, polyalkylene, acrylamide, acrylic acid, cellulose, ethers of cellulose, esters of cellulose, cellulose amides, polyvinyl acetate, polycarboxylic acids and salts, polyaminoamide or peptides, polyamides, polyacrylamide, copolymers of maleic/ acrylic acids, polysaccharides including starch and gelatine, natural gums such as xanthan gum and gum gum karaya, and mixtures thereof. More preferably, water-soluble or dispersible film comprises: polyacrylates and water-soluble acrylate copolymers, methylcellulose, carboxymethylcellulose, dextrin, ethylcellulose, hydroxyethyl cellulose, hydroxypropyl methylcellulose, maltodextrin, polymethacrylates, and mixtures thereof. Most preferably, water-soluble or dispersible film comprises: polyvinyl alcohols, copolymers of polyvinyl alcohol, hydroxypropyl methylcellulose (HPMC), and mixtures thereof. Preferably, the level of polymer or copolymer in the film is at least 60% by weight. The polymer or copolymer preferably has a weighted average molecular weight of from 1000 to 1000000, more preferably from 10000 to 300000, d�more preferably from 15,000 to 200,000 and most preferably from 20,000 to 150,000.

Can also be used copolymers and mixtures of polymers. This can be in particular useful for the control of mechanical properties and/or dissolution properties of the compartments or the products are standard dose, depending on their application and specific needs. For example, it may be preferred that the mixture of polymers is present in the film, if one polymer material has a higher solubility than another polymer material, and/or one polymer material has a higher mechanical strength than another polymer material. The use of copolymers and mixtures of polymers can have other benefits, including improving the long term sustainability of water-soluble or water-dispersible film to detergent ingredients. For example, US 6,787,512 reveals copolymer film of polyvinyl alcohol containing a hydrolyzed copolymer of vinyl acetate and a second monomer sulfonic acid, for improved resistance to detergent ingredients. An example of such a film is sold by Monosol from Merrillville, Indiana, US, under the brand name: M. It may be preferable to use a mixture of polymers having different weighted average molecular weight, for example a mixture of polyvinyl alcohol or its copolymer with a weighted average molecular weight of from 10000 to 40000 and the other polyvinyl alcohol or a copolymer� with a weighted average molecular weight of from 100000 to 300000.

Also useful are polymer mixtures, for example containing hydrolytically degradable and water-soluble polymer blend such as polylactide and polyvinyl alcohol, obtained by mixing polylactide and polyvinyl alcohol, typically containing from 1 to 35% by weight polylactide and about 65% to 99% by weight of polyvinyl alcohol. The polymer in the film can be hydrolyzed from 60% to 98% , more preferably from 80% to 90%, to improve the dissolution/dispersion of the film material.

Water-soluble or water-dispersible film in this application may contain additional ingredients, in addition to the polymer or copolymer material. For example, it may be useful to add plasticizers, such as glycerol, ethylene glycol, diethylene glycol, propylene glycol, sorbitol and mixtures thereof; additional water and/or agents of decay.

Other suitable examples of commercially available water-soluble films include polyvinyl alcohol and partially hydrolyzed polyvinyl acetate, alginates, cellulose ethers such as carboxymethylcellulose and methylcellulose, polyethylene oxide, polyacrylates and combinations thereof. Most preferred are films with properties similar to the properties of the films containing polyvinyl alcohol known under the brand M, which is sold by Monosol, Merrilville, Indiana, US.

A method of producing and re-mixing

The preferred method of producing a non-aqueous compositions in accordance with the present invention includes a stage on which (i) provide a non-aqueous liquid raw material; (ii) combine the cationic cellulosic polymer with a non-aqueous liquid feedstock; and (iii) combine the cellulose enzyme is combined with a nonaqueous liquid raw material and a cationic cellulose polymer. Alternatively, the cellulose enzyme can be added before adding the cationic cellulose polymer. Preferably, a cationic cellulose polymer and/or cellulose enzyme can be added as part of a premix or as a dispersion of particles. If cationic cellulose polymer is added as part of a premix, or a dispersion of particles, premix or dispersion particles preferably contains from 1% to 35%, more preferably from 10% to 25% by weight of cationic polymer. Cellulose enzyme is preferably added as a premix in a premix with propandiol and/or water. Cellulose premix may contain from 5 mg/g to 50 mg/g, preferably from 10 mg/g to 20 mg/g of cationic cellulase.

Non-aqueous feedstock may contain some or all of the remaining ingredients, including anionic and/or nonionic surfactants. In another implementation of the method may include the step of forming the outside�it structure-forming premix and joins an outer structure forming the premix with a cationic cellulose polymer, or non-aqueous raw material, or the combined dispersion of a cationic cellulosic polymer /cellulase/ non-aqueous liquid raw material.

Non-aqueous liquid composition may be contained in the product standard doses. This product is a standard dose can be obtained in accordance with methods known in the art. For example, water-soluble or water-dispersible film is cut to a desired size, and then folded to form the necessary number and size of offices. Edge then hermetically sealed using any suitable technology, for example, thermal welding, wet seal or sealing under pressure. Preferably, the source of hermetic sealing are brought into contact with the specified tape, apply heat or pressure to the hermetic sealing of the film material.

Water-soluble or water-dispersible film, typically, is injected into a mold and applying a vacuum so that the film is flush with the inner surface of the mold, forming an indent or niche in the specified material film. This is called vacuum forming. Another acceptable method is thermoforming. Thermoforming typically includes a step of forming water-soluble or water-dispersible foams in the mold under the influence of heat, h�about allows the specified film to deform and take the shape of the mould.

Typically more than one piece of water-soluble or water-dispersible material film is used for the manufacture of the product standard doses. For example, the first chunk of the film material can be vacuum drawn into the mold so that the first piece of film material is flush with the inner walls of the mold. The second piece of the film material may be positioned such that it completely overlaps with the first piece of the film material. The first piece of the film material and the second piece of the film material hermetically sealed together. The first and second pieces of water-soluble or water-dispersible film may be made of the same material or may be different materials.

The method of obtaining the product of the standard dose with multiple compartments, a piece of water-soluble or water-dispersible material film is formed, at least twice, or, at least, three strips of film material is used, or at least two pieces of film material is used, where at least one piece of film material is folded at least once. The third piece of the film material, or a folded piece of material protectors, creates a barrier layer that, when the materials of the film are hermetically sealed together, divides the internal volume prod� standard dose into two or more branches.

The product standard doses with multiple compartments can also be obtained by fitting a first piece of film material into a mold. Composition, or its components, may then be poured into the mold. Pre-formed compartment can then be placed over the mold containing the composition, or component. Pre-formed Department also preferably comprises a composition or a component. Pre-formed Department and specified the first piece of water-soluble or water-dispersible material film are hermetically sealed together to form the product of the standard dose with multiple compartments.

The present invention also provides a method for re-mixing the non-aqueous liquid composition according to the present invention with the second non-aqueous composition, characterized in that the second non-aqueous composition comprises a polymer based on cellulose, preferably cationic cellulose polymer. Alternative polymer cellulose-based second non-aqueous composition may be an anionic cellulosic polymer, such as carboxymethyl cellulose and/or carboxymethyl cellulose, modified ester.

TEST METHODS

1) Measurement of pH:

the pH was measured in pure composition at 25°C using Santarius RT-10P pH meter with �spruce probe (e.g., the Toledo probe, part number 52 LLC 100), which is calibrated in accordance with the instructions.

2) Method of measuring particle size:

Occhio Flow Cell FC200-S (Angleur, Belgium) was used to measure the distribution of particle sizes. A sample containing particles for analysis, was diluted to 2% by weight, with PEG200 to ensure the detection of one particle. 2 ml of the diluted samples were analyzed in accordance with the instructions supplied with the device.

3) Method of measuring the solubility of water-soluble or water-dispersible films:

5.0 grams±0.1 gram of the water-soluble or water-dispersible film was added to a previously weighed beaker 400 ml and added 245 ml±1 ml of distilled water. The mixture was vigorously stirred on a magnetic stirrer set at 600 rpm, for 30 minutes. Then the mixture was filtered through a filter of sintered glass with a pore size of up to 20 microns. The water was dried from the collected filtrate by any traditional method, and the mass of the remaining material is determined (which was a dissolved or dispergirovannoyj fraction). You can calculate the solubility in percent or dispersibility.

4) Method of measuring time of the dissolution of water-soluble or water-dispersible films:

The film was cut out and mounted in a foldable frame slide for slide n�sister 24 mm by 36 mm, without glass (part number 94.000.07, Else comes, The Netherlands, however, there may be used plastic folding frame from other suppliers).

Standard glass beaker, 600 ml was filled with 500 ml of tap water at 10°C and stirred with a magnetic wand for stirring, so that at the bottom there was a vortex at a height of 400 ml graduations on the glass.

The frame of a diapositive secured by clamps to the vertical bracket and suspended in water, 36 mm horizontal side along the diameter of the Cup so that the edge of the frame of a diapositive 5 mm were given for the side of the glass, and the top of the frame of the slide was at an altitude of 400 ml graduations Stopwatch was started immediately after placing the frame of the slide in water, and stopped when the film was completely dissolved. This time, it was registered as "the time of dissolution of the film".

5) Method of assessment of beneficial effects of soft non-aqueous liquid compositions;

Characteristics of softness was evaluated using the following procedure:

Terry cloth and cotton knitted fabric supplied Boechout "Beschutte Werkplaats" Company, Antwerp, Belgium, were used as test fabrics. Washing was performed with standard Western European wash conditions using a Miele washing machines W467 front loading. Washing was carried out with the ISP�Lovanium cycle "crushing-release' at 40°C, using water having a hardness of 2.5 mmol/L. Loading consisted of four samples of Terry cloth (direct loop, without woven pattern, 20 cm2300 g/m2), four samples of knitted cotton fabric (100% cotton, fabric for underwear, 20 cm2, 40/45 optic white, 165-175 g/m2), and ballast from covers for pillows, t-shirts and knitted towels of the same weight to give a total load for washing 2.5 kg. of the Test samples was linearly dried for at least 24 hours at a controlled temperature/humidity 21°C and 50% relative humidity.

Test cloth was evaluated by two graders scores-expert on a scale from 0 to 4, compared with the control (tissue washed in accordance with the same Protocol using a reference detergent compositions). We used the following rating scale:

0 - there is no difference

1 - I suppose I can see the difference

2 - I can see the difference

3 - I see a big difference

4 - I see a very big difference.

EXAMPLES

Examples 1-3: non-Aqueous liquid composition according to the present invention containing a cationic cellulosic polymer (LK400, LR400 or JR30M) and cellulose enzyme (Carezyme).

Example 4: non-Aqueous liquid composition according to the present invention containing a cationic cellulosic polymer (JR30M) as a suspension in the form of particles (ISOE�isua PEG as a dispersant), and cellulose enzyme (Carezyme).

Example 1Example 2Example 3Example 4
The ingredient nameWT%WT%WT%WT%
Linear alkylbenzenesulfonate acid16,6715,8115,8115,81
C12-14 alkyl 3-ethoxylated sulfuric acid9,729,49,49,4
C12-14 alkyl 7-ethoxylate14,3At 13.84At 13.84At 13.84
Citric acid0,680,660,660,66
C12-18 fatty acidQuick 8.948,658,65 8,65
DTPA (diethylenetriaminepentaacetic acid)1,181,181,181,18
Carezyme0,01150,01150,01150,0115
Polymer LK40010,51--0.5 G
Polymer LR4001-0,51--
Polymer JR30M1--0,51-
Pluriol E200 (polyethylene glycol 200)---1,5*
Polyethyleneimine ethoxylate PEI600 E208888
PEG6000-PVAc/glycol 6000-polyvinyl acetate copolymer 4444
MonoethanolamineTo pH 7,5To pH 7,5To pH 7,5To pH 7,5
1,2-propandiol11111111
Glycerin5555
Dye0,010,010,010,01
Water9,5101010
Various additives/minor additivesTo 100To 100To 100To 100

1Comes Dow Chemicals

2LK400 in the form of particles, is added as a suspension in an aqueous dispersant (Pluriol E200)

Non-aqueous liquid compositions of examples 1-4 were also encapsulated into polyvinyl�irtool film (M, comes Monosol), with the formation of products of standard dose containing liquid.

Non-aqueous liquid compositions of examples 1-4, and related products standard dose all provide good useful effect mitigation and clean, even during prolonged storage (e.g., during storage for 4 weeks at 35°C).

Example 5 is a non-aqueous liquid composition according to the present invention containing a cationic cellulosic polymer (LK400) and cellulose enzyme, obtained by repeated mixing of the comparative example 1, a premix containing enzyme, contaminated cellulose enzyme, in comparative example 2 containing a cationic cellulosic polymer.

Comparative example 1Comparative example 2Example 5
The ingredient nameWT%WT%
Linear alkylbenzenesulfonate acid15,8116,6716,67
C12-14 alkyl 3-ethoxylated sulfuric acid 9,49,729,72
C12-14 alkyl 7-ethoxylateAt 13.8414,314,3
Citric acid0,660,680,68
C12-18 fatty acid8,65Quick 8.94Quick 8.94
DTPA (diethylenetriaminepentaacetic acid)1,181,181,18
Protease0,16-Of 0.0016
Mannanase0,0035-0,000035
Amylase0,0234-0,000234
Cellulase (like pollution)0,0009-0,000009
LK4001-0,51 0,51
Polyethyleneimine ethoxylate PEI600 E20888
PEG6000-PVAc/glycol 6000-polyvinyl acetate copolymer444
MonoethanolamineTo pH 7,5To pH 7,5To pH 7,5
1,2-propandiol111111
Glycerin555
Dye0,010,010,01
Water109,59,5
Various additives/minor additivesTo 100To 100To 100

1Comes Dow Chemicals

The resulting composition is then maintained for 5 weeks at 35°C along with the composition of the CPA�comparative example 2. The useful effect of softness obtained for both compositions was evaluated in comparison with comparative example 1. From the table below, you can see that the example 5 preserves the beneficial effect of softness after storage, even if it contains 0,000009% by weight of cellulose enzyme.

The PSU rating (compared to the comparative example)
Comparative example 2+1,0
Example 5+0,9

The dimensions and values shown in this application are not to be construed as strictly limited to the exact numerical values you specify. Instead, unless otherwise specified, each such dimension shall mean both the specified value and a functionally equivalent range surrounding that value. For example, the size is described as "40 mm" is intended to mean "about 40 mm".

1. Liquid composition for textile care, which contains:
(a) a cationic cellulose polymer, which is characterized by structural formula I:

where:
a. m means an integer from 20 to 10,000;
b. each R4represents H; R2and R3each represents H;�zhdy R 1independently selected from the group consisting of H and
where:
n means an integer selected from 0 to 10; and
each R5represents H;
Rx is a
;
where A-is an acceptable anion; and
each R6independently selected from C1-C32alkyl; and
(b)cellulose enzyme;
the liquid composition comprises less than about 20% by weight of water.

2. The liquid composition according to claim 1, characterized in that the composition contains less than about 15% by weight of water.

3. The liquid composition according to claim 1, characterized in that the composition contains less than about 12% by weight of water.

4. The liquid composition according to claim 1, characterized in that the composition contains less than about 8% by weight of water.

5. The liquid composition according to claim 1, characterized in that the cationic cellulose polymer is a cationic polysaccharide.

6. The liquid composition according to claim 1, characterized in that it comprises from about 0.01% to about 20% by weight of a cationic cellulosic polymer.

7. The liquid composition according to claim 1, characterized in that it comprises from about 0.1% to about 15% by weight of a cationic cellulosic polymer.

8. The liquid composition according to claim 1, characterized in that it comprises from about 0.6% to p�blithedale 10% by weight of a cationic cellulosic polymer.

9. The liquid composition according to claim 1, characterized in that it contains from approximately 0,000005% to about 0.2% by weight of cellulose enzyme.

10. The liquid composition according to claim 1, characterized in that it comprises from about 0.00001 to about 0.05% by weight of cellulose enzyme.

11. The liquid composition according to claim 1, characterized in that it comprises from about 0,0001% to about 0.02 mass% of cellulose enzyme.

12. The liquid composition according to claim 1, characterized in that it is a composition of detergent for washing and further comprises an inhibitor of cellulase, which is present at a level of from about 0,0001% to about 3% by weight of the nonaqueous composition.

13. The liquid composition according to claim 1, characterized in that the cationic cellulose polymer is present in the form of particles.

14. The liquid composition according to claim 1, characterized in that the composition is in a water soluble or dispersible film.

15. The liquid composition according to claim 1, characterized in that the water-soluble or water-dispersible film contains a resin selected from the group consisting of: polyvinyl alcohols, copolymers of polyvinyl alcohols, hydroxypropylmethylcellulose (HPMC) and mixtures thereof.

16. Liquid composition for textile care, encased in a water-soluble or water-dispersible film containing:
(a) cationic cellulose�second polymer; and
(b) cellulose enzyme;
this non-aqueous liquid composition comprises less than about 20% by weight of water and a cationic cellulose polymer has the structural formula I:

where:
i. m means an integer from 20 to 10,000;
ii. each R4represents H; R2and R3each represents H; each R1independently selected from the group consisting of H and
where:
n means an integer selected from 0 to 10;
each R5represents H;
Rx is a
;
where A-is an acceptable anion; and
each R6independently selected from C1-C32alkyl; and
in addition, water-soluble or water-dispersible film contains a resin selected from the group consisting of: polyvinyl alcohols, copolymers of polyvinyl alcohols, hydroxypropylmethylcellulose (HPMC) and mixtures thereof.



 

Same patents:

FIELD: chemistry.

SUBSTANCE: invention relates to dispersive detergent composition, where composition contains surface-active substance and/or washing component, protease and protease inhibitor. Protease represents subtilisin or 10R protease, where protease is present in concentration 1E-09 - 2E-03 mol/kg of detergent, ratio of inhibitor to protease constitutes 0.1-1000 mol of inhibitor/mol of protease, and where protease inhibitor represents peptide aldehyde. Versions of peptide aldehydes are given in the formula of invention. Invention also relates to method of obtaining said detergent composition, to application of composition for washing soiled products and to method of removing egg pollution.

EFFECT: obtaining detergent composition with increased washing ability of protease.

19 cl, 4 ex

FIELD: chemistry.

SUBSTANCE: claimed invention relates to biochemistry and represents detergent composition, which includes version of subtilisin, which has amino acid sequence, given in SEQ ID NO 1, and, at least, one additional ingredient, selected from: i) bleaching substances, selected from percarbonates, persulphates and organic peracids, ii) aminocarboxylates, or iii) sulphonated polymers, or iv) organophosphoric acids or their salts and their mixtures. Invention also relates to method of removal or reduction of soiling of protein-like substances from surfaces which have such soiling, with application of claimed composition.

EFFECT: claimed composition demonstrates good results in removal of soiling of protein-like substances, even in compositions with alkaline pH values.

20 cl, 2 tbl, 2 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes a version of thermolysin, which has an improved efficiency in comparison to thermolysin of a wild type. The above version of thermolysin contains a replacement chosen from T006G, F063P, T006H, S065K, T006I, S065Y, T006K, Y075G, T006M, Y075M, T006N, Y075T, T006P, Q128H, T006Q, Q128I, T006R, Q128L, T006V, Q128M, T006W, Q128V, T006Y, Q128Y, V007F, Y151D, V007H, Y151E, V007K, Y151H, V007L, Y151K, V007M, Y151M, V007P, Y151N, V007Q, Y151Q, V007R, Y151R, V007T, Y151T, V007Y, Y151V, T049G, T049H, I156M, T049I, I156R, T049K, I156T, T049L, I156W, T049N, G196R, T049P, Q273I, T049Q, Q273P, T049W, Q273Y, A058I, T278K, A058P, T278M, A058R, T278P, F063I, N280K, F063L, N280R. Thermolysin is obtained by transformation of Bacillus sp. with an expression vector containing a polynucleotide sequence coding a version of thermolysin and by cultivation of a transformed host cell under conditions suitable for production of the above thermolysin. This ferment is used as a part of a cleaning composition for cleaning of surfaces or items.

EFFECT: obtaining a version of thermolysin with improved efficiency.

55 cl, 9 dwg, 3 tbl, 8 ex

FIELD: chemistry.

SUBSTANCE: present invention relates to a dispersed bleaching composition which contains the following, with respect to the total weight of the composition: a) from about 15% to about 80% oxygen-containing bleaching agent; b) from about 0.01% to about 20% surfactant; c) and from about 0.00005% to about 0.3% enzyme, where said enzyme: i. exhibits endo-beta-1,4-glucanase activity (E.C.3.2.1.4); and ii. exhibits more than approximately 80% maximum activity at pH 9.2 when measurements are taken at 40°C; and iii. does not contain a class A carbohydrate-binding module (CBM), and were the weight ratio of available oxygen to the surfactant is more than approximately 0.45.

EFFECT: obtaining a dispersed bleaching composition based on oxygen-containing peroxide bleaching agents with unexpectedly improved cleaning action and bleaching characteristics, as well as high fabric safety.

14 cl, 3 ex, 1 tbl

FIELD: chemistry.

SUBSTANCE: group of inventions relates to biotechnology. Disclosed is a composition for producing a fragrant ester. The composition contains SGNH-acyltranferase, an alcohol substrate containing 2-10 carbon atoms, and an acyl donor which is an ester substrate containing an acyl chain consisting of 2-10 carbon atoms. The alcohol substrate and the acyl donor are selected such that they produce a fragrant ester. Also disclosed is a method of producing a fragrant ester, according to which SGNH-acyltransferase, the alcohol substrate and acyl donor are combined in acyltransferase reaction conditions. Also disclosed is a method for simultaneous production of a bleaching agent, which is a peracid, and a fragrant ester. To this end, the SGNH-acyltransferase, alcohol substrate, acyl donor and aqueous hydrogen peroxide solution are combined in acyltransferase reaction conditions. The disclosed composition is used in detergents for removing stains, which contain at least one triglyceride, and for reducing unpleasant smells.

EFFECT: said SGNH-acyltransferase catalyses transfer of the acyl group from the acyl donor to the alcohol substrate to form a fragrant ester in an aqueous medium.

19 cl, 18 dwg, 9 tbl, 14 ex

FIELD: chemistry.

SUBSTANCE: invention relates to peptide aldehydes with tyrosine as C-end residue, which are especially efficient for stabilization of subtilisin-type proteases in liquid detergents.

EFFECT: obtaining novel composition.

6 cl, 3 ex

FIELD: biotechnologies.

SUBSTANCE: described method consists in provision of a composition for washing of dishware and dishware to be cleaned, bringing of the above dishware into contact with the above dishware washing composition under conditions that contribute to effective cleaning of the above dishware, where the above dishware washing composition contains modified subtilisin, where the above modified subtilisin is at least by 70% homological to the following sequence: AQSVPWGISRVQAPAAHMIGLTGSGVKVAVLDTGISTHPDLN1RGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATS LGSTNLYGSGLVNAEAATR and contains (i) replacement G116V and at least one additional mutation; or (ii) replacement S126R.

EFFECT: invention allows removing protein contaminations from dishware with high efficiency and is safe for users and environment.

6 cl, 6 ex

FIELD: biotechnologies.

SUBSTANCE: invention proposes use of a composition containing transglycosidase ferment (EC 2.4.1.24) for decomposition of polysaccharide of natural gum. The above polysaccharide of natural gum is a substrate for the above ferment of transglycosidase. A natural gum destruction method is described, which involves contact of transglycosidase ferment with polysaccharide of natural gum for destruction of the above polysaccharide of natural gum. Besides, a cleaning method is proposed, which involves contact of an object contaminated with polysaccharide of natural gum with cleaning composition including transglycosidase ferment; and maintenance of the above object and cleaning composition under conditions sufficient for effective destruction of polysaccharide of natural gum, and thus, cleaning of the above object.

EFFECT: invention allows decomposing natural gums by means of transglycosidase ferment.

19 cl, 7 dwg, 4 ex

FIELD: biotechnologies.

SUBSTANCE: compositions containing active versions of alpha-amylase are proposed. Besides a new version of alpha-amylase, compositions as per the invention usually contain at least one additional ferment, a detergent, one surface-active substance, one complexing agent, an oxidiser, an acidifying agent, an alkaliser, a peroxide source, a harness source, salt, a detergent complexing agent, a polymer, a stabilising agent or a conditioner. Besides, application methods of those compositions for scouring of woven fabric, for washing or cleaning of products, such as dishware or linen, which are contaminated with starch-containing substances, are described.

EFFECT: improved thermal stability relative to parental; form of AmyS-like alpha-amylase, from which they have been obtained.

10 cl, 12 tbl, 24 dwg, 14 ex

FIELD: chemistry.

SUBSTANCE: invention relates to a liquid hand dishwashing detergent composition which contains: (a) 0.001-10 wt % cationic polymer and (b) 0.005-3 wt % active inorganic mother-of-pearl agent having particle size smaller than 50 mcm, and the cationic polymer is a carboxyethyl cellulose salt. The present invention relates to a method of cleaning dishes.

EFFECT: obtaining a dishwasher detergent which cares for skin, particularly correction of cysts and skin lustre.

22 cl, 12 ex

FIELD: chemistry.

SUBSTANCE: invention relates to bleaching compositions in the form of sacks with several compartments. Described is a sack with several compartments, containing the first compartment and the second compartment, with the first compartment containing a solid composition, and the solid composition contains a source of an oxygen bleaching agent, a bleaching activator, a polycarboxylate polymer, representing a copolymer of maleic acid/acrylic acid, and the second compartment containing a liquid composition, and the liquid composition contains a low molecular solvent, with the sack material being made in the form of a water-soluble film.

EFFECT: improved stability over time.

17 cl, 2 tbl

FIELD: chemistry.

SUBSTANCE: invention relates to versions of cationic polyelectrolytic composition for application in personal care products and household chemicals and method of its obtaining. Composition includes: 1) cationic synthetic water-soluble polyelectrolyte, which contains (meth)acrylamide polymer and one or several of the following substances: I) cationic (meth)acrylamide monomer, and II) cationic monomer of (meth)acrylic acid, and III) hydrolysis-resistant cationic monomers, where polyelectrolyte has weight average molecular weight from approximately 10000 to approximately 2000000, charge density from, 0.001 to 2.5 meq./g, and level of acrylamide monomer that did not react constitutes less than 50 ppm, 2) surface-active substance and 3) solvent.

EFFECT: preparations, obtained on the base of composition, possess higher transparency.

17 cl, 3 dwg, 12 tbl, 106 ex

Laundry detergents // 2547257

FIELD: chemistry.

SUBSTANCE: invention relates to laundry detergents. Disclosed is a laundry detergent containing a granular foam control composition and an anionic surfactant, wherein the granular foam control composition contains a foam control agent, a composition of organic additives, a water-soluble inorganic carrier in the form of particles and a charged cationic polymer. The foam control agent contains liquid polydiorganosiloxane liquid, hydrophobic filler and an organosilicon resin. The invention also discloses a fabric cleaning method, a method of saving water during laundry and a method of saving time during laundry using the disclosed detergent.

EFFECT: disclosed detergent composition provides a satisfactory foam volume during the washing stage and a considerably low foam volume after rinsing once.

12 cl, 2 tbl, 9 ex

Aerosol soap // 2544444

FIELD: chemistry.

SUBSTANCE: invention relates to cosmetics and specifically to a soft cream soap in an aerosol package, and can be used as baby soap. Described is an aerosol soap containing the following components, wt %: soap base obtained through saponification of stearic acid with triethanolamine 2.5-9.0, glycerine 2.0-6.0, Laureth-23 0.5-3.0, hydrocarbon propellant 5.0-10.0, water - the balance.

EFFECT: ensuring the required soap plasticity to endow soap suds with different shapes, high safety of the soap while preserving basic functional properties thereof, high foam stability.

6 cl, 4 tbl, 1 ex, 1 dwg

FIELD: chemistry.

SUBSTANCE: invention relates to stable soluble single-dose articles. Described is a fabric care article containing a non-aqueous liquid composition containing a cationic polymer - cationic cellulose, a fatty acid or a salt, water and an anionic surfactant, wherein the cationic polymer is present in the form of particles. Also described is a method of producing a single-dose article.

EFFECT: providing a fabric care article without deterioration of film solubility or useful effect in fabric care.

9 cl, 3 tbl, 7 ex

FIELD: chemistry.

SUBSTANCE: invention relates to liquid surface-active composition, suitable for application as sealing for control over movement of liquids in products, as means for hand washing as cleaning substance. Described is liquid surface-active composition, containing anionic surface-active substance, selected from the group of compounds, in amount from approximately 90 % to approximately 99.9 % of composition weight and cationic surface-active compound, selected from the group, in amount from approximately 0.1 % to approximately 10 % of composition weight, with composition swelling in presence of water and physiological fluids. Absorbing product for personal hygiene and protective product are also described.

EFFECT: provision of solution, which swells in contact with fluids, and reduction of liquid leak inside porous substrates.

13 cl, 1 dwg, 4 tbl, 4 ex

FIELD: chemistry.

SUBSTANCE: described is a non-aqueous liquid composition for fabric care, which contains a cationic polymer in particle form, a non-aqueous dispersant selected from a group consisting of ethanol, glycerol, polyethylene glycol with molecular weight from about 100 to about 400, and less than 20% water; wherein the cationic polymer is stably dispersed in the non-aqueous liquid composition, and the non-aqueous liquid composition is encapsulated in a water-soluble or dispersible film.

EFFECT: stability of the composition without reducing solubility of the film, useful softness effect.

18 cl, 16 ex

FIELD: chemistry.

SUBSTANCE: claimed invention relates to a water-based composition, suitable for application for personal hygiene, in everyday life and in organisations, which includes: a) certain quantity of a capable of association thickening agent, including a polymer composition, which contains a water-soluble or water-swellable main chain of a synthetic polymer, which contains a bound with covalent bond ends and/or intermediate blocks of oligomer hydrophobic compounds, selected from the group, including I) alkyl and aryl structures, containing a capable of polymerisation cyclic monomer, II) capable of polymerisation double bond, III) derivatives of compounds, listed in I) and II), with blocks representing two or more units of similar or different hydrophobic compounds, b) certain quantity of a surface-active substance, c) certain quantity of a physiologically tolerable salt, selected from the group, including sodium sulphate, potassium chloride and sodium chloride, and d) water; with the quantity of the capable of association thickening agent, contained in the water-based composition constituting from 0.1 to 5 wt %, the quantity of the surface-active substance, contained in the water-based composition, constituting from 5 to 50 wt %, and the polymer composition, including the water-soluble or water-swellable main synthetic polymer chain, includes polyacetal polyether, modified with ethylhexylglycidyl ether (EHGE).

EFFECT: obtaining water compositions based on surface-active substances, demonstrating Newton viscosity at lower shear rates and shear thinning at higher shear rates, with the provision of a possibility to apply different quantities of the surface-active substances, including the reduced quantity of the surface-active substances.

15 cl, 7 ex, 5 tbl, 1 dwg

FIELD: chemistry.

SUBSTANCE: described is a bag, which contains, at least, one hermetically fastened compartment, containing the first composition, with, at least, one wall of, at least, one hermetically fastened compartment being manufactured from a water-soluble film of any acceptable thickness, with the film containing, at least, 50 wt % of water-soluble resin of polyvinyl alcohol (PVA), with the PVA resin having an average viscosity from approximately 13.5 cps to approximately 20 cps and a degree of hydrolysis in the range from approximately 84% to 92%, and the PVA resin contains a mixture of the first and second PVA polymers, with the viscosity of the first PVA polymer being lower than the viscosity of the second PVA polymer. The water-soluble film contains the PVA polymer in such a way that when the film is approximately 76 micron thick, the firm is characterised by the solubility index from approximately 620 to approximately 920 and the tension index from approximately 145 to approximately 626.

EFFECT: good solubility in cold water with aging, water-resistance to an impact of wet hands and mechanical properties.

13 cl, 15 tbl, 3 dwg

FIELD: chemistry.

SUBSTANCE: invention relates to a method of purifying a substrate, which can be represented by dishes or linen. The claimed method includes a contact of a substrate in the wash cycle with an aqueous cleaning solution, which contains water diluents and a solid detergent composition. The said composition contains an oligomer of glycolic and/or lactic acid with the average degree of polymerisation from 1.8 to 6, with the oligomer of glycolic and/or lactic acid providing a regulated release of glycolic and/or lactic acid in the cleaning solution, creating a gradient of acidic pH during the wash cycle. The claimed method makes it possible to eliminate the necessity of dosing a separate rinsing additive in a rinsing cycle due to the creation of the pH gradient during the wash cycle.

EFFECT: invention also relates to a solid multi-phase detergent composition, including the oligomer of glycolic and/or lactic acid with the average degree of polymerisation from 1,8 to 6.

10 cl, 1 dwg, 2 tbl, 2 ex

FIELD: chemistry.

SUBSTANCE: invention relates to stable soluble single-dose articles. Described is a fabric care article containing a non-aqueous liquid composition containing a cationic polymer - cationic cellulose, a fatty acid or a salt, water and an anionic surfactant, wherein the cationic polymer is present in the form of particles. Also described is a method of producing a single-dose article.

EFFECT: providing a fabric care article without deterioration of film solubility or useful effect in fabric care.

9 cl, 3 tbl, 7 ex

Up!