| 2509800 - 2509849 2509850 - 2509899 2509900 - 2509949 2509950 - 2509999 |
 |
Microcapsule-containing composition Present invention relates to a liquid detergent composition containing less than 20 wt % water, 10-89.9% of one or more surfactants, having alkyl or alkenyl chains containing more than 6 carbon atoms, wherein the surfactant is anionic, nonionic, zwitterionic, amphoteric or cationic; 10-60 wt % water-miscible organic solvent, having molecular weight greater than 70 and selected from a group consisting of ethers, polyethers, alkylamines and fatty amines, alkyl amides and mono- or di-N-alkyl-substituted derivatives thereof, lower alkyl esters of alkyl carboxylic acid, ketones, aldehydes, polyols and glycerides, and microcapsules of a fragrance, wherein the fragrance contained in the microcapsules includes: i) 1-30% of fragrance raw materials, having ClogP of less than 3 and boiling point lower than 250°C, and ii) more than 70% of fragrance raw materials selected from a group consisting of materials having ClogP greater than 3 or ClogP less than 3, with boiling point higher than 250°C. The present invention also relates to a liquid detergent composition encapsulated in a water-soluble film. |
 |
Method of using bacillus intermedius ribonuclease Invention refers to medicine and veterinary science. A method provides using bacterial 7P ribonuclease for increasing the effectiveness of suppression of RNA- and DNA-containing virus replication for treating acute viral diseases in mammals and warm-blooded animals. |
 |
Invention relates to biotechnology, specifically a method of producing artificial oligonucleotides that are potentially capable of forming non-canonical structures that stable in physiological conditions and conditions close to physiological, said structures being imperfect G-quadruplexes (lmGQ) which include one nucleotide substitution in the G4 plane in the G-quadruplexes (GQ). Said method includes using an algorithm describing nucleotide sequences in form of a defined set of formulae for further synthesis of selected oligonucleotides. |
 |
Method of producing continuous cell lines and use thereof Invention relates to biotechnology and a method of producing continuous lines of living cells and use thereof. The disclosed method involves irradiating said living cells with a UV light dose of about 20 mJ/cm2 to about 300 mJ/cm2, at a wavelength between about 100 nm and about 400 nm, for about 30 s to 5 min and collecting cells that are capable of proliferation after at least 20 passages. The obtained cell lines are deposited in ECACC under numbers 08020602, 08020603 and 08020604 and can be used to produce viruses or gene products. |
 |
Invention relates to molecular biology and can be used in diagnostic studies aimed at detecting acute intestinal infection (AII) agents. Disclosed is a set of differentiating oligonucleotides (probes), which enables to determine, in a biological sample, DNA of pathogenic microorganisms which cause AII, and specific identification thereof, where said microorganisms relate to a group which includes Shigella spp. and Enteroinvasive E.coli (EIEC), Salmonella spp., Campylobacter Jejuni, Proteus mirabilis, Klebsiella pneumoniae. |
 |
Method of obtaining recombinant antigen g2 of dobrava hantavirus in e.coli cells Invention relates to biotechnology and a method of obtaining a recombinant antigen G2 of hantaviruses. The disclosed method is characterised by that the DNA structure pGHF, which encodes a fused protein of three parts, where N-terminal position is occupied by a green fluorescent protein GFP, central position is occupied by a peptide of 73 amino acid residues with the amino acid sequence SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEW KDPDGMLKDHLNILVTKDIDFDT, and the C-terminal position is occupied by a mini-domain Foldon of coliphage fibritin JS98C3 (dwg 2), is introduced into E. coli cells; cells transformed by this structure are cultured, the biomass is lysed, the insoluble fraction of the lysate is separated by centrifuging, the product of expression in the form of inclusion bodies is solubilised with methylated spirit, chromatography is carried out and the obtained product is used to detect specific antibodies in serum of patients with hemorrhagic fever with renal syndrome. |
 |
Method of preparing grain material for fermentation Invention pertains to the alcohol industry. The method involves mixing crushed starch-containing material with water in the presence of amylolytic enzyme preparations, heat treatment of the mixture in hydrodynamic and enzymatic treatment apparatus, heating in a contact head to 108-110°C and cooking in a column-type apparatus. The cooked mass is cooled, followed by saccharification with saccharifying enzyme preparations in fermentation tanks in the presence of yeast cells which inhibit lactic bacteria. |
 |
Invention relates to biotechnology and a method of detecting O-glycosylated proteins in cell homogenates that are prepared for proteomic and phosphoproteomic analysis. The disclosed invention can be used to perform proteomic and phosphoproteomic analysis. The method involves performing two-dimensional electrophoresis, followed by identification of spots using MALDI-TOF spectroscopy and phosphoproteomic techniques. The cell homogenates are desalinated by gel-penetrating chromatography or dialysis. The cell homogenates are subjected to glycosylation based on a β-elimination principle in a 0.05 M NaOH solution which contains 38 mg/ml NaBH4 for 16 hours at +45°C, followed by addition of cyanine dye JC-1 in concentration of 10-6 M. The cell homogenates are incubated for 15 minutes at room temperature. The homogenates are concentrated by precipitation with 50% acetone, subjected to two-dimensional electrophoresis to form electrophoregrams which are analysed for fluorescence when illuminated on a blue light transilluminator with an amber light filter, which visually appears in form of strips which are fluorescent in the dark. Said strips are extracted from the gel and used to perform proteomic or phosphoproteomic analysis. Further analysis of intensity and arrangement of the extracted strips is performed by comparing silver nitrate-coloured electrophoregrams of homogenates before and after a deglycosylation procedure. |
 |
Invention refers to oncology and molecular biology. What is presented is a method for determining the non-small cells lung cancer sensitivity to the preparations reactivating protein p53, involving the recovery of RNA from samples, the synthesis of complementary DNA of the genes CDKN1A, BTG2 and E2F1 by reverse transcription and real-time polymerase chain reaction, and the determination of a relation of the amount of complementary DNA of the gene E2F1 to the amount of complementary DNA of the gene CDKN1A or the gene BTG2, wherein if observing the relation of E2F1/CDKN1A>3 or E2F1/BTG2>1.5, the non-small cells lung cancer cells are considered to be sensitive to the preparations reactivating protein p53. |
 |
Methods of treating and diagnosing cancer Invention relates to biotechnology and specifically methods of forecasting development of cancer and can be used in medicine. The method of performing forecast for a patient suffering from NSCLC involves determining the expression level of ChoK beta or ChoK beta and ChoK alpha in a sample collected from said patient. Low levels of ChoK beta relative to the levels in a standard sample indicate a bad forecast for the patient. Low levels of ChoK alpha and high levels of ChoK beta relative to the expression levels of said proteins in the standard sample indicate a good forecast for the patient. |
|
Method of producing mineral tanning agent Sulphate titanyl-containing and aluminium-containing salts and ammonium sulphate are mixed. The sulphate titanyl-containing salt used is crystalline titanyl sulphate and the sulphate aluminium-containing salt used is aluminium-ammonium alum or aluminium sulphate. The components are mixed in weight ratio of TiO2:Al2O3:(NH4)2SO4=1:0.02-0.1:1.7-2.5 and then reacted in solid-phase mechanical activation mode while supplying energy at a rate of 2-5 kW-h/kg of the mixture for 15-50 minutes to form a tanning agent. Before reacting the components, water can be added to the mixture in an amount of not more than 3.5 wt % with respect to the weight of the mixture. The disclosed method is characterised by a 5.5 times shorter duration on average and enables to reduce consumption of ammonium sulphate 1.75-2.25 times while avoiding use of sulphuric acid. The obtained composite tanning agent with content of the active titanium component of 17.6-22.7 wt % with respect to TiO2 has basicity of 40-43.6%. |
|
 |
Proposed method comprises feed of solid material into arc furnace, its melding by electric arc fired by at least one electrode. Weight measure is defined for solid material bulk accumulated at furnace wall to control melting process parameters on the basis of defined measure. Model of forced oscillations is used for definition of solid material bulk accumulated at furnace wall. |
 |
Method of hot rolling of strip from silicon steel Proposed method is implemented at unit combining continuous casting and rolling at the step that follow. a) furnacing the steel of the following chemical composition, in wt %: Si - 2-7, C - 0.01-0.1, Mn<0.3, Cu - 0.1-0.7, Sn<0.2, S<0.05, Al<0.09, Cr<0.3, N<0.02, P<0.1, Fe and unavoidable impurities making the rest b) furnacing the 25-150 mm-thick billet at continuous casting plant. c) strip rolling at 4 passes directly after casting. Note here that at least in one pass reduction degree exceeds 30% while total reduction of all passes exceeds 50%. d) strip heating to final temperature to 1050-1250°C, preferably to 1100-1180°C. e) finish strip rolling at second rolling mill. f) strip cooling and coiling. |
 |
Electric sheet steel with oriented grain structure Electric sheet steel comprises flute formed from geometrical location of laser beam scanning points from one end edge to opposite edge of the sheet over sheet width, and crystalline grain interface line. Said line extends along said flute to penetrate the silicon steel sheet from front surface to rear surface. Note here that glass coat is made in said flute with Ir X-ray radiation intensity factor of magnesium at flute section is set to 0≤Ir≤0.9. Note here that mean X-ray radiation characteristic intensity of magnesium of textured electric steel other than flute section is set to 1. |
 |
Electric sheet steel with oriented grains and method of its production Steel containing Si is subjected to cold rolling, decarburizing annealing for primary recrystallisation, sheet coiling and coil group annealing for secondary recrystallisation. Steel sheet coil is unwound and straightened. Right between cold rolling and coiling, silicon sheet steel is irradiated by laser beam multiple times in definite intervals from one end to another over sheet width. At secondary recrystallisation, boundaries of grains extending from front surface to rear surface along laser beam paths. |
|
Charge for waelz process for zinc-lead-tin-bearing materials Proposed charge comprises calcium-containing material and solid carbonaceous reducing agent. Note here that is additionally contains zinc-iron-bearing sulphide product while calcium-bearing material as limestone at the following ratio of component, in wt %: zinc-lead-tin-bearing material - 47-54, zinc-iron-containing sulphide product - 5-8, solid carbonaceous reducing agent - 21-23, limestone making the rest. |
|
|
Method of making cobalt-based alloy for cermet and clasp dental prosthesis Proposed method comprises smelting in vacuum-induction furnace and casting in vacuum of bars in split moulds of square or round profile with square side of diameter not over 12 mm, respectively. Cast alloy contains following substances, in wt %: carbon - 0.03-0.30, silicon - 0.7-2.5, manganese - 0.25-1.0, chromium - 27.5-30.5, molybdenum - 3.5-6.0, nickel - not over 0.5, iron - not over 0.3, boron - 0.03-0.10, cobalt and unavoidable impurities making the rest, [%Si]/[%C] ratio of said alloy is ≥4.0. Alloy features lower hardness, better machinability at appropriate mechanical, carrion and casting properties. |
|
 |
Invention can be used as a structural material for parts operated at high mechanical and thermal loads, for example, pistons of augmented ICEs operated at 350°C and higher. Proposed composition contains the following substances, in wt %: silicon - 12.05…14.65, nickel - 2.80…3.40, iron - 1.50…1.70, aluminium oxide - 1.05…1.30, carbon - 1.35…1.65, aluminium making the rest. |
 |
Method of making composite material Hardening agent powder is prepared by mechanical doping of the mix of nanopowders of boron-bearing material in amount of 2-25 wt % of the mix for making composite and tungsten in amount of 1-30 wt % of said mix obtain composite powder mix of uniformity of 75-85 %. Powder of aluminium or its alloys is added to produced mix in amount of 100 wt % of aforesaid mix to go on with mechanical doping for 0.5-5 hours at the rate of 100-1000 rom. Obtained mix is degassed at 0.6-0.8 of aluminium fusion point, sintered and subjected to hot extrusion through die hole at 3000-15000 MPa at the press of capacity not lower than 500 t. |
 |
Active material of negative silicon alloy-based electrode for electric device Proposed active material contains the alloy of composition formula SixTiyZnz, where each of x, y and z is the mass percent content satisfying the relationship x+y+z=100, 38≤x<100, 0<y<62 and 0<z<62. Negative electrode comprises said active material. Electric device represents a storage battery with active material of negative electrode. |
 |
Method of defining machinability of cast iron with vermicular graphite at machine tools Proposed method comprises establishing the relationship between cuttability and content of carbide-stabilising elements in cast iron with vermicular graphite. Note here that said relationship is defined empirically from measured cuttability and content of carbide-stabilising elements in multiple specimens of cast iron with vermicular graphite. Said cast iron with vermicular graphite is used to define the content of carbide-stabilising elements in multiple specimens of cast iron with vermicular graphite. It includes definition of cuttability by indicated relationship 1 and contents of carbide-stabilising elements in multiple specimens of cast iron with vermicular graphite. It comprises definition of at least one first preset reference cuttability of cast iron with vermicular graphite for large-scale mechanical assembly. Cuttability of cast iron with vermicular graphite is classified in comparison with cuttability at first preset reference magnitude. |
 |
Alloy composition, fe-based nanocrystalline alloy and method of its making and magnetic assy Invention covers the alloys FeaBbSicPxCyCuz, where 79≤a≤86 at.%, 5≤b≤13 at.%, 0<c≤8 at.%, 1≤x≤8 at.%, 0≤y≤5 at.%, 0.4≤z≤1,4 at.% and 0.08≤z/x≤0.8, and FeaBbSiePxCyCu, where 81≤a≤86 at.%, 6≤b≤10 at.%, 2≤c≤8 at.%, 2≤x≤5 at.%, 0≤y≤4 at.%, 0.4≤z≤1.4 at.% and 0.08≤z/x≤0.8. Proposed method comprises producing the alloy to be heat treated under condition that temperature rise rate makes 100°C or more per minute and that process temperature is not lower than that the alloy crystallisation start. |
 |
Production of metal strip with coat that features improved appearance Metal trip is driven through molten pool. Then, coated strip is blown by atomisers spraying gas at every side of the strip. Note here that oxidising capacity of said gas is lower than that of atmosphere consisting of 4 vol. % of oxygen and 96 vol. % of nitrogen. Then, the strip is driven through isolation zone. Said zone is confined at its base by lowing line and top surface of said atomisers. From above it is limited by top part of two isolation chambers arranged at every strip side, directly above said atomisers, and at least 10 cm above said blowing line. On sides, it is limited by sides of aid isolation chambers. Oxidising capacity of atmosphere in said isolation zone is lower than that of atmosphere consisting of 4 vol. % of oxygen and 96 vol. % of nitrogen and higher than that consisting of 0.15 vol. % of oxygen and 99.85 vol. % of nitrogen. |
|
Method of making protective decorative coatings on wood articles Beforehand, wood surface is coated with first ply of epoxy resin and second ply of epoxy resin with aluminium powder at 1:1 ratio. Deposition of metal or alloy plies is effected by plasmatron at the power of 3.9 kW and plasma-forming gas flow rate of 0.8 m3/min. |
|
 |
Surface processing by arc discharge in vacuum Arc discharge cathode spots are initiated at processed surface, arc discharge being initiated between anode and cathode in the mode of voltage-current characteristic of increasing section, said cathode being a processed surface. Region of cathode spot location on processed surface is localised and processed surface is shifted by anode displacement. Anode with current-collecting surface area smaller than that of cathode is used and placed at the distance from cathode that ensures a positive anode voltage drop. |
 |
Method of coat application on copper contacts of electric switching devices Proposed method comprises ion-plasma spraying of molybdenum on copper contact. Spraying is started at voltage across copper contact of 1100-1500 V and heating to volumetric temperature of 180-230°C.Then, spraying is conducted at reference voltage across copper contact of 110-130 V to make 2-4 mcm-thick coat layer. Then, voltage is increased across copper contact to 1100-1500 V to allows spraying duration of 0.3-0.5 of that for spraying said one mcm-thick coat. Thereafter, spraying is performed at voltage increased many times to said increased voltage and decreased to said reference voltage to produce required thickness. |
 |
Method of timber metal coating Timber surface is coated with a ply of liquid glass prior to deposition. Ply of aluminium powder is powdered on non-solidified surface of aforesaid ply. Deposition of metal or alloy plies is effected by plasmatron at the power of 4.5 kW and plasma-forming gas flow rate of 0.5 m3/min. |
 |
Hot formed element and method of its production Hot formed element of coated sheet steel surface layer comprises are of Ni diffusion, intermetallide compound layer and ZnO layer. Said layers are overcoated with Ni diffusion area. Intermetallide compound layer corresponds to γ-phase displayed at Zn-Ni alloy phase equilibrium diagram. Said layer has intrinsic potential of submersion in air-saturated water solution of NaCl with 0.5 mol/l concentration at 25 °C±5°C in the range of -600 to -360 mV relative to standard hydrogen electrode. Said element is produced by heating sheet steel with Ni-based coat containing on its surface a layer of coat from Zi-Ni alloy containing 13 wt % of mote of Ni in the temperature range of Ac3 transition to 1200°C with subsequent hot forming of steel sheet. |
 |
System and method for producing chemical potential energy Invention relates to a system and a method for producing chemical potential energy and can be used in producing efficient fuel, which can be used in clean energy processes where greenhouse gases and other pollutants are neither formed nor emitted. The system for dissociating gases includes a gas component separator, an electron source capable of emitting electrons, an electric field generator, an anode and an intermediate electrode. The cathode is thermionic. The generator has energy which is sufficient for dissociation of molecules of reaction gases. The anode lies at a predetermined distance from the cathode, said distance limiting the reaction gas chamber. The gas chamber can cause interaction between electrodes and reaction gas molecules. The intermediate electrode lies next to the separator and the cathode. The intermediate electrode is capable of dissociating molecules through electrolysis on the surface of the separator to form products. Molecules of the reaction gas are at least molecules of either CO2 or H2O. The products are O2 and at least one of CO and H2. Furthermore, the method of dissociating gas molecules involves feeding molecules of reaction gases into a reactor. The reactor has a cathode, an anode and a separator between the anode and the cathode. The method involves generating an electric field between the anode and the cathode, having energy sufficient for dissociation of a reactant and for reducing molecules of reaction gases via electrolysis. The method also involves heating the electron source, having a thermionic cathode, in order to release free electrons therefrom. O2 and molecules of other products are separated and molecules of the product are output. The gas molecules are at least molecules of either CO2 or H2O. The product consists of O2 and at least one of CO and H2, or a mixture of CO and H2. |
 |
Method of producing chlorine, caustic soda and hydrogen Invention relates to a method of producing chlorine, an alkali metal hydroxide and hydrogen, and a computer-controlled device for carrying out the disclosed method, wherein the method includes the following steps: (a) preparing brine by dissolving an alkali metal chloride source in water; (b) removing the alkaline precipitate from the brine obtained at step (a) in the presence of hydrogen peroxide or in the presence of at most 5 mg/l active chlorine using an activated carbon filter and obtaining ready brine; (c) treating at least a portion of the ready brine obtained at step (b) at an ion-exchange step; (d) treating at least a portion of brine obtained at step (c) at an electrolysis step; (e) separating at least a portion of chlorine, alkali metal hydroxide, hydrogen and brine obtained at step (d); (f) treating at least a portion of brine obtained at step (e) at a dechlorination step, carried out in the presence of hydrogen peroxide; and (g) recycling at least a portion of the dechlorinated brine obtained at step (f) to step (a). |
 |
Electrolytic cell for production of aluminium On hearth surface placed are baffles and/or grates, and/or open-pore cellular structures wetted by aluminium made of material with lower electric conductivity compared with that of aluminium perpendicular and/or at 45°-90° to heart surface, perpendicular and/or at 45°-90° to lengthwise axis of cathode rods preventing partially or completely the flow of horizontal components of cathode currents in aluminium layer along the hearth. Electrolytic cell can operate with consumable or nonconsumable anodes, that is, "inert" anodes. |
 |
Aluminium electrolytic cell anode holder Anode holder comprises support with two and more nipples arranged regularly or at different spacing along lengthwise axis of calcined carbon block and secured at nipple seats made therein. Note here that nipples have contractions with cross-section area making 0.3-0.9 of nipple cross-section area in anode assy termination. Said contractions are made above carbon assy at 0.01-0.2 to 0.21-0.9 of the distance from carbon anode surface to horizontal part of the surface. |
 |
Method of electrolytic application of metal coatings Metal coating is applied by electrochemical deposition from electrolyte whereto additive of polyphosphate or the mix of polyphosphates are added in amount of 0.1-450 g per one liter of electrolyte. Note here that the metal is selected from the group of noble metals including silver and metal of platinum group. |
 |
Method and device for hydrolysis of cellulosic material Method of hydrolysis comprises the stages: a) impregnating the wood cellulosic material with the first alkali (pH 10-14), such that the first alkali is in contact with the lignin inside the lignin-containing wood cellulosic material, b) passing the wood cellulosic material through the vessel at atmospheric pressure, c) supplying ultrasound to the zone of depleted oxidation. The stage of impregnation includes creating a process flow of wood cellulosic material and the first alkali; use of vacuum impact on the process flow, increase of pressure, which impact the process flow is subject to. At atmospheric pressure the vessel comprises: a tubular casing with a closed lower end, a counterflow tubular casing located inside the said tubular casing and having an open lower end, at that between the tubular casing and the counterflow tubular casing there is an outer reaction annular channel, and the zone of depleted oxidation near the lower closed end of the tubular casing. |
|
Method of manufacturing paper resistant to moisture and dirt comprises processing of the porous paper web on both sides with the composition based on an aqueous dispersion of polymers, imparting to paper resistance to moisture and dirt, removing the excess of aqueous dispersion from the porous paper web, and drying. Processing of the porous paper web with the said aqueous dispersion is carried out in an impregnating bath. Removing the excess of aqueous dispersion from the web is carried out by passing the impregnated web between the squeezing press shafts, on the surface of which the coating is preliminary applied, comprising telomers obtained by free-radical polymerization of tetrafluoroethylene. |
|
 |
Support board (1) of a rail track has a shape of isosceles trapezoid and comprises two channels on its upper side in the form of slots for placement of rails. Channels (8) stretch from one end surface (2) of the support board to the other one (3) and have bent or arched shape. The convex side (16) of channels (8) faces the shorter side surface (6) of the board (1). The set of boards represents boards arranged one after another, one of which is alternately laid into a condition turned by 180 degrees. |
|
Rail joint design comprises a standard butt pad, two connected standard rails. The standard butt pad is welded to the side surface of the standard rail only after it occupies its working position after assembly of the joint and tightening of joint bolts. Connection of the rail with the pad at the other side is made as detachable. |
|
 |
In the proposed device ballast is cut from sleeper-to-sleeper space and end of sleepers with a working element. The working element is a frame with holes in vertical and horizontal plane, combs and feed switch with traction fingers. Combs are hingedly fixed on the frame axis. Combs make reciprocal movements with the help of a drive. The drive is arranged outside the rail track. |
 |
Method and device for production of asphalt mixture Method for production of an asphalt mix, in which the removed asphalt in the form of asphalt crumb and/or new material in the form of grain fillers together or separately are heated and dried in drum plants and then in the mixing plant mixed with bitumen, forming the asphalt mixture suitable for laying. Besides, mixing of heated and dried asphalt crumb and/or grain fillers is carried out in gaseous medium with low oxygen content, oxygen content in which makes maximum of 10%. Drying and heating of asphalt crumb and/or grain fillers is carried out in drum plants with the help of gases with low content of oxygen, which have temperature in the range from 500 to 1000°C, and then moved into the mixing plant. Moving and mixing is also carried out in gaseous medium with low content of oxygen, besides, cold gases are sent into the supply system and into the mixing plant with low oxygen content, which have temperature in the range from approximately 20 to 150°C, or cooled gases with low oxygen content, having temperature in the range from approximately 150 to 300°C, and bunkering of the heated and dried asphalt crumb and/or grainy fillers prior to mixing with bitumen and/or bunkering of finished asphalt mixture is also carried out in the gaseous medium with low oxygen content. Also the device is described for production of asphalt crumb. |
 |
Method to compact hot asphalt-concrete mixture by rolling with road roller In the method of compaction of a hot asphalt-concrete mix by rolling with a road roller, which comprises four working elements that are combined in pairs as two balance trucks, mounted onto rotary platforms relative to the frame of the roller, compaction is carried out as a row of cycles. Each cycle in its first half consists in the fact that trucks are arranged at the edges of the compacted strip, and at the first stage they roll these edges, and subsequent stages are carried out by displacement of trucks towards each other with closure of the previously compacted division. The first half of the cycle is completed by rolling of the central part of the strip with tandem arrangement of balance trucks. The second half of the compaction cycle consists in reverse movement of trucks towards the edges of the strip. Full compaction of the strip is carried out in 2-3 cycles with preservation of the overlapping condition. |
 |
Method to create elements of structures for construction of marine city Method consists in filling of a shell with evaporated sea salt, shaping the shell as the construction block. When an air impermeable shell is used, underpressure is developed inside it. |
 |
Monolithic system of a base with a resistant composite coating from homopolymer having semi-continuous configuration comprises load-distributing elements for formation of seams. Comprises a base that includes blocks from polystyrene foam and a bearing semi-continuous cement-concrete coating, the formwork for which is formed by blocks from polystyrene foam that are part of the base. Load-distributing elements are made in the form of load-distributing plates. Each of load-distributing plates comprises two anchors with two reinforcement bars for setting the position of the seam shaper and a hinged joint made as capable of counterclockwise rotation under action of a support moment, developed by the load, and clockwise rotation under action of the support moment developed by load-distributing plates. |
 |
Method to increase bearing capacity of bored pile Method to increase bearing capacity of bored piles consists in the fact that each bored pile is made of two elements; the lower part - from loose working substance (crushed stone, slag and similar material) interacting with a soil base, besides, the foot of the working substance lies deeper than the depth of soil freezing, the upper part of the pile is erected as solid, reinforced concrete with a cross-shaped head. The solid reinforced concrete grill is erected, and the whole structure is partially erected. Pairs of jacks-pulsators of double reciprocal action are mounted onto cross-shaped heads, their plungers are rested against the structure grill. Pairs of jacks-pulsators are connected by oil lines with a pulsating pump station. From the panel, jacks-pulsators are switched on, and pulses are applied to press the upper solid part of the pile deep down, using the foot of the solid pile, the working substance is pressed into loose soil base, the form of the working substance contact surface is transformed with the soil base into a drop-like, pear-like shape, pressed with the surface of the contact of the working substance of the weak soil base under it and around it, previously they stress, seal and strengthen these weak loose zones of the soil base, to the rated value of force. Using the manometers, they monitor pressure developed by a pair of jacks-pulsators, the bearing capacity of each pile is increased several times. Strength and deformability of the zone of contact of the soil base with the working substance is balanced. The bearing capacity of piles is balanced in respect to each other, and uneven subsidence is prevented, and the structure list is eliminated. |
 |
Working equipment of hydraulic excavator Ripper tip is made with a U-shaped stand and a bracket at the rear side, and also by hydraulic fixators in the bracket and in the U-shaped stand. The ripper tip is fixed to the handle by one hinged joint together with the bracket and as capable of disconnection with a crank with the help of a hydraulic fixator in the U-shaped stand. Also with the possibility of connection in non-working condition to a hinged joint on the handle with the help of a hydraulic fixator in the ripper tip bracket. In working position, i.e. during tillage, the ripper tip is connected to the crankshaft by the hydraulic fixator in the U-shaped stand. Hydraulic fixators in the bracket and in the U-shaped stand of the ripper tip installed in the transverse plane of the ripper tip comprise hydraulic cylinders of double-sided action. Stems of hydraulic cylinders are connected to sliding fixators capable of entering the hinged joints on the handle and in the crankshaft. |
 |
Method to control source of vacuum in vacuum sewage system Vacuum, i.e. pressure level, and efficiency of the system is maintained and controlled, whilst controlling the speed of rotation of a source/sources of vacuum measured by number of rotations per minute. The source of vacuum has a liquid-ring screw pump driven by an electric motor. Number of rotations per minute of each motor in the system is controlled by means of a programmable logical controller. The controller is programmed to maintain the one first source of vacuum as connected, until it reaches the specified maximum number of rotations per minute, with subsequent connection of the next, second, source of vacuum, if the vacuum system requires higher efficiency of pumping. The programmable logical controller may also be programmed to control the number of rotations per minute for each source so that sources operate with identical speed of rotation in the range from least or highest number of rotations per minute depending on the required vacuum, but with connection of the additional source of vacuum, when higher efficiency is required. |
 |
Connection head and system for assembly of structures (its versions) Invention relates to a connection head for a system of assembly of structures with one upper end and one lower end. A middle longitudinal axis is stretching between the upper and lower end, and at least one connection flange arranged between upper and lower end with the support surface for beam adjacency. According to the invention the connection flange and the support surface have side displacement relative to the radial plane to the longitudinal axis, and the support surface is arranged in parallel to the radial plane. |
 |
Device to prevent icicle formation Device comprises a knockdown element on protruding parts of the roof, which may move reciprocally in the plane that normally crosses the zone of icicle growth, connected to a drive fixed on the building wall by means of brackets under the protruding part. The drive is made in the form of two flat blades fixed hingedly on the wall and equipped with wind traps. The knockdown element is made in the form of a double-edged knife hingedly fixed to the blades. |
 |
Ventilation system of pitched roof Ventilation system of a pitched roof comprises an inclined ventilation channel arranged under the roof. Inlet and outlet holes of the channel are ventilation windows and slot untightnesses between the roof and the walls of the building, and the lower wall of the channel is a hydraulic heat insulating screen, placed in parallel to slopes of the roof and made of two layers of the hydraulic insulating material, for instance, from reinforced polyethylene film, between which an air layer is formed. In both layers of the film there are holes for passage of heat insulating ventilation channels of the building, taken through an attic room and the roof into environment. In places where exits are located from the attic to the roof in the hydraulic insulating screen there are hatches made in the form of frames, where removable covers are installed. Edges of films that adjoin the floor of the attic room are lowered into the trays installed on the floor. |
 |
Wall lining comprising wall panels (1) and fastening profiles (2), comprising a location slot (4) open at the bottom for the lower wall panel (1), a location slot (3) open at the top for the upper wall panel (1) and a slot (5) for suspension of fastening hooks, besides, both location slots (3, 4) that form a support surface (9) on the side facing away from the wall (6) for the external side of the wall panels (1) in the fastening profiles (2) fixed on the wall (6) create at least two sections (11) in direction towards the slot bottom, and these sections (11) have different width for fixation of wall panels (1) of different thickness, the cross section of location slots (3, 4) of fastening profiles (2) narrows at least gradually in direction towards the bottom of the slot, besides, the slot (5) for suspension of fastening hooks is arranged between both location slots (3, 4). |
 |
Set for floor installation comprises two elements: a detachable surface coating and a fastening substrate based on PVC and containing at least 60 wt % of plasticiser. |
Another patent 2513400.