From mammals (C07K14/47)

Polybacterial drug with advantages for health: with antioxidant effect, decreased cholesterol concentration, anti-inflammatory and immuno-modulating effect, and release of bioactive peptides inhibiting angiotensin-converting enzyme // 2627651
FIELD: biotechnology.SUBSTANCE: group of inventions refers to polybacterial probiotic drug including new strains of lactic acid bacteria Lactobacillus gasseri 7/12 NBIMCC No. 8720, Lactobacillus plantarum F12 NBIMCC No. 8722 and Lactobacillus helveticus A1, NBIMCC No. 8721, which has anti-inflammatory immunomodulatory, hypocholesterolemic, antioxidant and antihypertensive activity. The group of inventions also refers to the use of drug as a probiotic agent, as well as an agent which has anti-inflammatory immunomodulatory, hypocholesterolemic, antioxidant and antihypertensive activity.EFFECT: food additives, food and functional products, pharmaceutical preparations that include this drug, have a beneficial effect on the health of people and animals.9 cl, 8 dwg, 15 tbl

Engineered repeat protein binding with serum albumine // 2625882
FIELD: biotechnology.SUBSTANCE: invention relates to production of new engineered proteins with binding specificity for serum albumin, which can be used in medicine. Proteins including the ankyrin repeat domain, as well as nucleic acids encoding such proteins and pharmaceutical compositions comprising such proteins for diseases treatment are produced recombinantly.EFFECT: invention allows a significant increase in blood plasma half-life compared to proteins that do not bind serum albumin.18 cl, 4 dwg, 3 tbl, 6 ex

Proteins binding to hepcidin // 2625011
FIELD: biotechnology.SUBSTANCE: lipocalin mutein is obtained which is at least 90% identical to the protein sequence selected from a group consisting of sequences SEQ ID NO: 1-14.EFFECT: invention allows for producing lipocalin mutein able to bind to hepcidin with an affinity based on the dissociation constant which is equal to approximately 10 nm or less.73 cl, 12 dwg, 11 ex

ethod for pancreatic cancer detection // 2624040
FIELD: medicine.SUBSTANCE: presented methods for pancreatic cancer detection include measurement of the presence or amount of a polypeptide having a reactivity in the form of specific binding with the CAPRIN-1 protein antibody via antigen-antibody interaction, or the presence or amount of a nucleic acid encoding this polypeptide, in a sample derived from an individual, wherein the polypeptide to be measured is CAPRIN-1 protein consisting of the amino acid sequence corresponding to any of even-numbered SEQ ID NO: 2-30, and wherein the presence or amount of nucleic acid encoding the polypeptide is determined by the nucleic acid encoding the polypeptide contained in the sample.EFFECT: invention allows simple detection of malignant tumours of pancreatic cancer.27 cl, 5 ex

odified peptides and their application for treatment of autoimmune diseases // 2620070
FIELD: medicine, pharmacy.SUBSTANCE: this invention relates to the field of biotechnology, particularly to an immunosuppressive agent, and can be used for the treatment of systemic lupus erythematosus (SLE). A peptide is obtained, consisting of the amino acid sequence IHMVYSKRSGKPRGYAFIEY [SEQ ID NO: 2] in which serine in position 9 is phosphorylated and methionine in position 3 is oxidized or of RIHMVYSKRSGKPRGYAFIEY [SEQ ID NO: 1], in which serine in position 10 is phosphorylated and methionine in position 4 is oxidized.EFFECT: invention provides peptide or salt thereof, effective in systemic lupus erythematosus treatment.8 cl, 6 dwg, 4 tbl, 4 ex

Recombinant plasmid pet-15b_t3_rl dna providing synthesis of recombinant fusion protein consisting of tumor-specific peptides and antitumor peptide rl2, and recombinant fusion protein possessing anti-tumor activity against human breast cancer // 2619053
FIELD: biotechnology.SUBSTANCE: pET-15b_T3_RL plasmid DNA is constructed which provides synthesis of recombinant fusion protein consisting of a tumor-specific peptide and an antitumor peptide RL2. The recombinant fusion protein isolated from Escherichia coli cells transformed with pET-15b_T3_RL plasmid, has a molecular weight of 15.9 kDa, consists of methionine residue, tumor specific peptide YTYDPWLIFPAN, glycine GGGS spacer, and a recombinant lactaptin RL2 analogue.EFFECT: production of a protein providing cytotoxic activity against cancer cells in culture and targeted properties for tumor tissue.2 cl, 6 dwg, 5 ex

Recombinant plasmid pet-15b_t1_rl dna providing synthesis of recombinant fusion protein consisting of tumor-specific peptides and antitumor peptide rl2, and recombinant fusion protein possessing cytotoxic activity against cancer cells and targeted properties against tumor tissue // 2619050
FIELD: biotechnology.SUBSTANCE: pET-15b_T1_RL plasmid DNA is constructed which provides synthesis of recombinant fusion protein consisting of a tumor-specific peptide and an antitumor peptide RL2. The recombinant fusion protein isolated from Escherichia coli cells transformed with pET-15b_T1_RL plasmid, has a molecular weight of 15.7 kDa, consists of methionine residue, tumor specific peptide GLHTSATNLYLH, glycine GGGS spacer, and a recombinant lactaptin RL2 analogue.EFFECT: production of a protein providing cytotoxic activity against cancer cells in culture and targeted properties for tumor tissue.2 cl, 6 dwg, 5 ex

Ledgf peptides and their compositions for treatment of degenerative diseases // 2617964
FIELD: biotechnology.SUBSTANCE: invention relates to production of full-length fragments of the eye lens epithelial growth factor (LEDGF), and can be used in medicine. LEDGF fragment with SEQ ID NO: 2 is obtained, which is used in pharmaceutical compositions for treatment of diseases associated with protein aggregation.EFFECT: invention can effectively treat diseases associated with protein aggregation, in particular ocular diseases.15 cl, 31 dwg
Recombinant protein mio-hsp, method of its production, injection preparation for muscle mass increase in farm animals, birds and animals of canids, as well as method of using preparation // 2613420
FIELD: biotechnology.SUBSTANCE: present invention relates to biotechnology and can be used for increasing muscle mass of farm animals, livestock and canines. Fused protein is obtained, consisting of myostatin, Gli-Ser spacer and glucan binding domain of alpha-glucan binding domain of Streptococcus mutans (Mio-HSP), that is used to produce injection preparation for subcutaneous or intramuscular injections in a dose of 50–200 mcg of said protein per one kg of animal body weight or poultry. For producing recombinant protein is grown cell strain E. coli M15 [rMio-HSP] - producer of recombinant protein myocardial HSP, which is obtained by transformation of cells of E. coli M15 plasmid rMio-HSP M15 containing a nucleotide sequence gene coding myocardial HSP, then bind protein myocardial HSP in paragraph 1 in the cell extracts strain E. coli M15 [rMio-HSP] with alpha-glucan binding sorbent by affine interaction incubation procedure, with further washing from unbound bacterial proteins and separating end product.EFFECT: invention allows to effectively induce synthesis of specific antibodies to myostatin, inhibit and, consequently, stimulate growth of muscular tissue.4 cl, 7 tbl, 6 ex

Block of ccl18 signaling through ccr6 as therapeutic method of treating fibrotic diseases and cancer // 2609649
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, namely to use of soluble polypeptide of CCR6 receptor in treating of interstitial pulmonary disease and/or lung cancer. Polypeptide containing CCLVYTSWQI, which consists of amino acid sequence, which has at least 90 % identity with respect to sequence according to SEQ ID NO: 9. Its fragment is also obtained, containing at least 12 amino acids of above sequence, including CCLVYTSWQI.EFFECT: invention allows preparing polypeptide capable to inhibit CCL18 induced step-down regulation of CCR6 expression.1 cl, 33 dwg, 17 ex

New allergen // 2608494
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, namely to novel horse allergens, and can be used in medicine for prophylactic or therapeutic treatment or diagnostics of type I allergy in horses. Horse allergen is obtained, which represents secretoglobin with molecular weight of 15 kDa in non-reducing conditions and contains first peptide chain with molecular weight of approximately 5 kDa and second peptide chain with molecular weight of approximately 10 kDa, linked to each other. Recombinant form of said allergen is also obtained.EFFECT: invention enables to obtain recombinant horse allergen with completely determined amino acid sequence.13 cl, 10 dwg, 3 tbl, 8 ex

Plasminogen and plasmin variants // 2604810
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology and can be used for production of plasminogen and plasmin variants. Version of plasminogen is obtained, containing activation site and catalytic domain, in which catalytic domain contains valine, substituted for isoleucine, in position 1 of catalytic domain of human plasmin or in position, corresponding to such in catalytic domain of plasmin, which differs from human plasmin where said catalytic domain of human plasmin starts with amino acid valine in position 1, which is the same amino acid valine in position 562 Glu-plasminogen of human with SEQ ID NO: 1.EFFECT: invention enables to obtain autoproteolytically stable variant of plasmin.19 cl, 14 dwg, 3 tbl, 2 ex

Plasminogen and plasmin variants // 2604807
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology and can be used for production of plasminogen and plasmin variants. Method comprises obtaining a variant of plasminogen, containing in its catalytic domain a replacement of glutamic acid with glutamine in position 138 of catalytic domain of human plasmin or in a position corresponding to such in a catalytic domain of plasmin other than human plasmin, where said catalytic domain of human plasmin starts with amino acid valine in position 1, which is same amino acid valine, occurring in position 562 of human Glu-plasminogen with SEQ ID NO: 1. wherein said variant of plasminogen can also contain a replacement of lysine with glutamic acid or histidine in position 147 and/or replacement of arginine with histidine in position 158 of catalytic domain of human plasmin.EFFECT: invention enables to obtain autoproteolytically stable variant of plasmin.33 cl, 14 dwg, 2 tbl, 2 ex

Recombinant plasmid dna pndctr1 coding hybrid polypeptide gst-ndctr1, escherichia coli bl21 (de3)/pndctr1 bacteria strain - producer of hybrid polypeptide gst-ndctr1 and hybrid polypeptide gst-ndctr1, making chelates of copper, silver and platinum ions // 2603092
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology and can be used for recombinant production of CTR1. Method comprises producing plasmid DNA pNdCTR1 coding hybrid polypeptide GST-NdCTR1, consisting of the N-terminal polypeptide fragment of glutathione-S-transferase (GST), connected via thrombin hydrolysis site with the polypeptide fragment of the N-terminal domain of a high-affinity human copper CTR1 (NdCTR1) importer. Size of the plasmid DNA is 5149 bps, the plasmid DNA comprises BamHI-XhoI - pGEX-4T-1 fragment with size of 4951 bps and SLC31A1 gene fragment with size of 198 bps, encoding the N-terminal domain of human CTR1 protein. Nucleotide NdCTR1 sequence and GST sequence are in the same reading frame. E.coli BL21(DE3) cells are transformed with the produced DNA pNdCTR1 to obtain an E.coli BL21 (DE3)/pNdCTR1 producer strain.EFFECT: invention allows producing hybrid polypeptide GST-NdCTR1 making chelates of copper, silver and platinum ions.3 cl, 4 dwg, 1 tbl, 5 ex

eans and methods for diagnosing and treating multiple sclerosis // 2601298
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, more specifically to use of peptide, consisting of at least 8 consecutive amino acid residues of the sequence set forth in SEQ ID NO: 3, for diagnosing multiple sclerosis, that can be used in medicine. Multiple sclerosis or a predisposition for multiple sclerosis in a subject are being diagnosed in case an anti-KIR4.1 antibody is present in the patient's sample.EFFECT: invention enables to obtain alternative means and methods for diagnosing and/or treating multiple sclerosis.9 cl, 8 dwg, 1 tbl, 6 ex

Tissue-regeneration promoter using recruitment of bone marrow mesenchymal stem cells and/or pluripotent stem cells in blood // 2599448
FIELD: medicine.SUBSTANCE: presented inventions relate to use of an agent stimulating tissue regeneration, and a method of stimulating repair of mesenchymal or epithelial neurological tissues by administering said agent. Described agent is an S100A8 protein, a cell which secretes an S100A8 protein, a vector into which DNA encoding S100A8 protein is inserted, an S100A9 protein, a cell which secretes an S100A9 protein or a vector into which DNA encoding an S100A8-9 protein is inserted.EFFECT: presented inventions can be used for inducing healing of injured tissues by recruiting bone-marrow-derived cells in area of damage, thereby treating such diseases as extensive pitting skin, bone fractures, cerebral infarction.7 cl, 44 dwg, 1 tbl, 9 ex

Biomarkers associated with pre-diabetes, diabetes and diabetes-related conditions // 2596486
FIELD: medicine.SUBSTANCE: invention relates to medicine and concerns a method, a test system for diagnosis of diabetic nephropathy. Disclosed method comprises determining in sample from a subject a biomarker, which is a similar CD5 antigen.EFFECT: using method enables to diagnose diabetic nephropathy.33 cl, 13 tbl, 4 dwg, 1 ex

Genetic nucleotide sequences of artificially modified gdnf with deleted pro-region, product of which has improved properties neural inductor and stimulator of formation of neural processes, suitable for therapy of neural injuries, ischemic strokes and neurodegenerative diseases, expression vector, modified with gdnf // 2595377
FIELD: biochemistry.SUBSTANCE: invention relates to biochemistry. Disclosed is cDNA of natural GDNF gene artificially modified by removal of pro-region, which in mammalian cells or tissues in standard vectors produces active specific GDNF. Invention also relates to an expression vector containing said cDNA, as well as to active specific GDNF encoded by said cDNA. During translation in cells and tissues said GDNF stimulates neural differentiation of stem and progenitor cells with formation of neural processes.EFFECT: invention increases activity of GDNF as neural inductor and stimulator of formation of neural processes and can be used in therapy of neurodegenerative disorders, traumatic disorders of innervation as well as ischemic cerebral apoplexies of mammals, including humans.3 cl, 13 dwg, 5 ex

ethod of inhibiting hiv replication in cells of mammals and humans // 2593948
FIELD: biochemistry. SUBSTANCE: invention relates to the field of biochemistry. Method of inhibiting replication of human immunodeficiency virus (HIV), involving treatment of mammalian cells with agent selected from group of peptides, interfering RNA or anti-sense oligonucleotide destructive structure proteins vimentin and/or keratin-10 of cytoskeletal intermediate filaments (IF) in mammal cell. Invention also relates to use of said agent for preparing drug for treating of HIV-infection. Besides, there are presented pharmaceutical compositions for treating of HIV-infection, containing said agent. EFFECT: invention increases HIV replication inhibition. 10 cl, 11 dwg, 2 tbl, 12 ex

Allergens produced by recombinant methods // 2592674
FIELD: biotechnology. SUBSTANCE: present invention relates to biotechnology, specifically to novel dog allergens, and can be used in medicine. Allergen Can f 4 is produced by recombinant method. Obtained allergen can be used during in vitro diagnosing or treating allergy, caused by dandruff or dogs wool. EFFECT: present invention enables to obtain allergen Can f 4 by recombinant method with completely determined amino acid sequence. 11 cl, 10 dwg, 5 tbl, 1 ex

Antibodies against isoforms of human protein oct-1, recombinant polypeptide and method of producing antibody // 2590715
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, genetic and protein engineering. Invention discloses a recombinant polypeptide, having specific immunogenic properties of isoforms Oct-1, comprising an N-end section of human Oct-1A, a linker and 6 histidine residues; as well as a method for preparing polyclonal antibodies against isoforms of Oct-1 using said polypeptide. Polypeptide has sequence MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHGAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQAFHHHHHH.EFFECT: present invention enables to produce antibodies binding isoforms of human Oct-1A, Oct-1L and Oct-1B and can also be used to produce antibodies with high affinity and specificity with other isoforms of Oct-1.2 cl, 6 dwg

Neuregulin antagonists and use thereof in treating malignant growth // 2587619
FIELD: biotechnology.SUBSTANCE: invention relates to method of increasing period of time to recurrence, and can be used in medicine. Neuregulin antagonists are obtained, which are anti-NRG1 antibody siRNK or shRNK targeted NRG1, or immune-adhesine to NRG1 for administering the previously recieved anticancer therapy, in combination with therapeutic agent specified in paclitaxel, cisplatin or their combination for delay time to recurrence or prevent development of cancer cell resistance to therapeutic agent.EFFECT: invention allows to increase period of time to recurrence, which increases survival rate of patients.10 cl, 8 dwg, 1 tbl, 8 ex
Peptidomimetic macrocycles // 2582678
FIELD: medicine, pharmaceutics.SUBSTANCE: invention refers to new peptidomimetic macrocycles and methods for using these macrocycles to modulate p53 and/or HDM2, HDMX activity.EFFECT: producing new compounds.33 cl, 8 dwg, 4 tbl, 13 ex

Apoptosis inhibitors and use thereof // 2582247
FIELD: biotechnologies.SUBSTANCE: invention relates to production of DAXX protein antiapoptotic fragments and can be used in medicine for treating acute myocardial infarction (AMI), cerebral infarction, during organ transplantation, operations on heart, acute blood circulation disorders, reperfusion injuries and ischaemia. Obtaining biologically active fragments form 17-24 sequential amino acids of DAXX protein including KKSRKEKKQTGSGPLG, as well as their peptide mimetics and conjugates with peptide penetrating into cells.EFFECT: invention allows effective inhibition of cell apoptosis, in particular cell apoptosis mediated by Fas receptor.22 cl, 17 dwg, 4 tbl, 1 ex

ethod for producing lactoferrin, lactoferrin-containing fraction and using it // 2579661
FIELD: medicine, pharmaceutics.SUBSTANCE: group of inventions refers to biotechnology. A raw material is presented by milk, which has not been processed at a temperature of more than 55°C. The above raw material is extracted on cation-exchange resin with using a concentrated solution of sodium chloride. A solution of primary milk protein containing lactoferrin, lactoperoxidase and other foreign matters is produced. The solution of primary milk protein is purified on cation exchange resin balanced with acetate buffer in the concentration of 50 mM at pH from 4 to 9. An elution procedure is ensured with using acetate buffer solutions in the concentration of 50 mM with the different concentrations of the sodium chloride solution - from 0.02 to 1.5 M. A lactoferrin-containing fraction is collected. The fraction contains more than 95% pure lactoferrin and is substantially free from lipopolysaccharides, endotoxins and angiogenin and has an iron saturation level from 9% to 20%. The produced fraction is applicable to accelerate maturation of a newborn's gastrointestinal tract or to recover a post-gastroenteritis intestinal mucosa, to increase monocyte activity and to improve the cytotoxic function of killer cells, as an anti-inflammatory agent, to reduce expression of anti-inflammatory cytokines, to inhibit or eliminate bacteria, to treat the diseases associated with bacterial films, to prepare solutions or ointments for wound cleaning or eye care, and to treat infectious respiratory diseases.EFFECT: method for producing lactoferrin, the lactoferrin-containing fraction and using it are presented.15 cl, 4 tbl, 11 dwg

ethod of use in therapy // 2579659
FIELD: bioengineering.SUBSTANCE: invention relates to use of the antigenic compound including the antigenic peptide produced from amyloid protein or amyloid-like protein for medical treatment of the disease, state or distress due to or linked with the said protein in population of patients suffering from insufficiency of T-cells during induction of the immune response. The said antigen peptide is modified by lipophilic or hydrophobic part of the molecule, that makes easier insertion to the lipidic double layer of the liposomal carrier/adjuvant, and is presented in form of frequently repeated matrix on surface of the liposome. The said antigen compound is used for medical treatment of the disease, state or distress due to or as result of amyloid protein or amyloid-like protein in amount sufficient for induction of the immune response independent from T-cells.EFFECT: invention permits use of the said antigen compound as per new medical application, namely, for medical treatment of the diseases, when it is desirable to generate immune bodies independent from T-helper cells, for example, at animals or people with the immunodeficiency or with autoimmune diseases, such as Alzheimer's disease.51 cl, 22 dwg, 6 tbl, 6 ex

Glycosylated congugates of molecules with repeating motif // 2574201
FIELD: chemistry.SUBSTANCE: invention relates to field of biochemistry, in particular to methods for obtaining glycosylated conjugate of molecule with repeating motif for binding with antibody, which includes the following stages: 1) obtaining cells; 2) cultivation of cells; 3) separation of glycosylated conjugate of molecule with repeating motif from cells; 4) optional purification of separated glycosylated conjugate of molecule with repeating motif.EFFECT: invention makes it possible to reduce content of by-products in the process of obtaining glycosylated conjugate of molecule with repeating motif.5 cl, 19 dwg, 7 ex

ethod of purifying growth factor protein // 2571926
FIELD: chemistry.SUBSTANCE: invention relates to biotechnology and particularly to a method of purifying G-CSF (granulocyte-colony stimulating factor) in a purification sequence using chromatography. The method includes performing chromatography at least once using a multimodal resin with a negatively charged ligand in the form of 2-(benzoylamino)butanoic acid. G-CSF is bound with the multimodal resin at pH in the range of 4-6.2. The G-CSF is eluted at pH higher than 6.3 or with an elution agent in an elution buffer, where said elution agent includes an amino acid having a backbone chain and/or high ionic force in the elution buffer selected from a group consisting of arginine, lysine and/or histidine. Concentration of the elution agent is in the range of about 0.1 M to about 2.0 M.EFFECT: present invention enables to obtain purified G-CSF with high output.14 cl, 14 dwg, 10 tbl, 11 ex

ethod for high-efficiency collection of functional cells in vivo // 2571230
FIELD: chemistry.SUBSTANCE: present group of inventions relates to biotechnology and methods of collecting functional cells (versions). The described solutions comprise implantation of an implantable medical vessel under the skin for not more than two weeks, where a cell population is immobilised in the vessel using any of the proteins HMGB1, HMGB2, HMGB3, S100A8, S100A9 or hyaluronic acid or mixtures of any two or more thereof. Said factors have an activity of attracting specific functional cells into the body.EFFECT: present inventions provide efficient and safe collection of biologically functional cells, particularly stem cells.7 cl, 37 dwg, 1 tbl, 12 ex

Novel molecule inhibitors of jnk // 2570417
FIELD: medicine.SUBSTANCE: invention relates to novel molecule inhibitors of JNK, methods of obtaining antibodies to said molecule inhibitors of JNK, as well as to respective antibodies and cells, producing said antibodies.EFFECT: obtaining novel molecule inhibitors of JNK.20 cl, 32 dwg, 4 tbl, 9 ex

Novel tumour biomarker // 2567005
FIELD: medicine.SUBSTANCE: invention relates to biochemistry. Method includes determination of level of polypeptide with said sequence in plasma by means of antigen, where Thr90 of polypeptide is phosphorylated. Also diagnostic sets for detection of presence of tumour metastases are described, for screening for presence of tumour among high risk population, for determination of prognosis for patient, for determination of efficiency of surgery, radiotherapy or chemical therapy with respect to patient with tumour, and/or determination of the time when treatment must be stopped. Diagnostic sets include polypeptide with sequence, given in materials, where Thr90 of polypeptide is phosphorylated.EFFECT: described are methods for detection of presence or metastases of tumour, screening for presence of tumour among high risk population, prognosis for patient with tumour, determination of efficiency of surgery, radiotherapy or chemical therapy.27 cl, 20 dwg, 18 ex

Versions of plasminogen and plasmin // 2564131
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to field of biotechnology, namely to obtaining versions of plasminogen and plasmin, containing one or several point mutations in catalytic domain, which reduce or prevent autocatalytic loss of plasmin protease activity, and can be used in medicine.EFFECT: invention makes it possible to obtain autoproteolytically stable plasmin.51 cl, 10 dwg, 3 tbl, 5 ex

Synthetic peptide for preparing monospecific antibodies against isoform 2 of eukaryotic translation elongation factor 1a // 2562880
FIELD: medicine.SUBSTANCE: what is presented is a peptide derivative for producing specific antibodies reacting to isoform 2 of translation elongation factor 1A (eEF1A2), but not reacting to isoform 1 of translation elongation factor 1A (eEF1A1), containing a fragment of the amino acid sequence of eEF1A2 in the position from 330 to 343. There are also presented method for producing the monospecific antibodies reacting to eEF1A2, but not to eEF1A1 on the basis of using the peptide derivative according to the invention, and using it for the affine purification of these monospecific antibodies.EFFECT: invention can be used for developing immune test systems for identifying cells with changed biological apoptosis control apparatus in biological samples capable of malignant transformation and tumourogenesis.3 cl, 9 dwg, 10 ex

Antibodies, containing therapeutic tpo/epo mimetic peptides // 2559526
FIELD: medicine.SUBSTANCE: claimed invention relates to field of biotechnology. Claimed are: therapeutic antibody and therapeutic antibody fragment for increasing production of platelets, including thrombopoetin (TPO) mimetic peptide, which contains sequence IEGPTLRQWLAARA, and inserted as addition to C-terminus of constant region of light chain and/or in position of less than 20 amino acids following C-terminus of hinge region of heavy chain. In addition, described are composition, containing antibody or its therapeutically active fragment, and method of increasing production of platelets in individual, including introduction of said composition, as well as nucleic acid, coding antibody polypeptide, containing TPO mimetic polypeptide.EFFECT: invention enables higher and faster production of platelets in comparison with knows structures of antibody, where mimetic peptide is inserted instead of one of CDR.13 cl, 4 dwg, 9 ex

External cow lipopolysaccharide epitope h. pylori // 2558257
FIELD: chemistry.SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.27 cl, 8 dwg, 21 tbl, 11 ex

Cell-penetrating peptides and thereof application // 2556800
FIELD: chemistry.SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).8 cl, 16 dwg, 1 tbl, 8 ex

Immunoprophylactic cancer vaccine // 2556128
FIELD: medicine, pharmaceutics.SUBSTANCE: present invention refers to biotechnology and represents an immunogenic composition for preventing and treating cancer diseases, which contains the non-functional BORIS protein, a sequence of which is free from the zinc finger protein. The present invention also discloses an immunotherapeutic cancer composition containing the above non-functional BORIS protein or a bacterial, mammalian or yeast cell, or a viral particle able to express the above non-functional BORIS protein. The present invention also discloses a method for immunising a patient by administering an effective amount of the above immunotherapeutic composition, as well as using the above immunotherapeutic composition for preparing the cancer vaccine.EFFECT: invention enables increasing the efficacy of the immunoprophylactic and therapeutic cancer vaccine.22 cl, 7 dwg, 2 tbl, 8 ex

Binding proteins inhibiting vegf-a receptor interaction // 2550258
FIELD: chemistry.SUBSTANCE: invention refers to biotechnology, specifically to VEGF-A specific binding proteins, and can be used in medicine for treating pathological angiogenesis in mammals. The antiangiogenic protein contains one ankyrin recurrent domain consisting of a N-terminal capping module of ankyrin recurrence, a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GH7EIVEVLLK8GADVNA (SEQ ID NO:5), wherein 1 represents an amino acid residue specified in A, N, R, V, Y, E, H, I, K, L, Q, S and T; 2 is specified in S, A, N, R, D, F, L, P, T and Y; 3 is specified in T, V, S, A, L and F; 4 is specified in W, F and H; 5 is specified in P, I, A, L, S, T, V and Y; 6 is specified in W, F, I, L, T and V; 7 is specified in L or P and 8 is specified in A, H, N and Y; a recurrent module presented by an ankyrin recurrent motif of the sequence 1D23G4TPLHLAA56GHLEIVEVLLK7GADVNA (SEQ ID NO:1), wherein 1, 2, 3, 4, 5, 6 and 7 independently represents an amino acid residue specified in the group of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y, and a C-terminal capping module.EFFECT: invention enables producing an antiangiogenic binding VEGF-A165 with Kd less than 10-7 M protein, which inhibits binding VEGF-A165 to VEGFR-2.12 cl, 4 dwg, 4 ex

Oligopeptide compounds and their applications // 2549675
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to the field of biotechnology, namely to obtaining oligopeptide compounds, containing a motive, interacting with a proliferating cell nuclear antigen (PCNA) and can be used in medicine. The oligopeptide compound consists of 14-70 amino acids and contains. a PCNA-interacting motive, representing [K/R]-[F/Y/W]-[L/I/V/A]-[L/I/V/A]-[K/R], at least one signal sequence of nuclear localisation and at least one signal sequence of penetration into a cell, with the PCNA-interacting motive being located towards an N-end relative to the signal sequence.EFFECT: invention makes it possible to carry out the efficient treatment of hyperproliferative disorders by the application of the oligopeptide compound in cyctostatic therapy or in radiotherapy as a sensitising substance.34 cl, 6 dwg, 4 tbl, 8 ex

uc-1 protein cytoplasmic domain peptides as cancer inhibitors // 2539832
FIELD: medicine, pharmaceutics.SUBSTANCE: invention refers to biotechnology, more specifically to MUC1 cytoplasmic domain peptides, and can be used in the anticancer therapy. A method for inhibiting MUC1-positive cancer cell in an individual involves administering into an individual the MUC1-peptide of the length of at least 6 sequential MUC1 residues and no more than 20 sequential MUC1residues and containing the sequence CQCRRK, wherein the amino terminal cysteine from CQCRRK is closed at its NH2 terminal by at least one amino acid residue, which shall not conform with the native transmembrane sequence MUC-1. Alternatively, there can be used MUC-1 peptide of the length of at least sequential MUC1 residues and no more than 20 sequential MUC1 residues, which contains the sequence CQCRRK with all amino acid residues of the above peptide being D-amino acids.EFFECT: invention enables inhibiting MUC1oligomerisation effectively and inducing the tumour cell apoptosis and the tumour tissue necrosis in vivo.80 cl, 16 dwg, 1 tbl, 3 ex
Casein succinylate of iron (iii) and method of its production // 2533826
FIELD: metallurgy.SUBSTANCE: invention relates to casein succinylate of iron (III) wherein iron content varies from 4.5 wt % to 7 wt %, water solubility exceeds 92% while phosphorus-to-nitrogen ratio exceeds 5 wt %.EFFECT: additionally, invention relates to production of iron (III) and to pharmaceutical composition containing casein succinylate of iron (III).17 cl, 4 tbl, 9 ex

Fused dlk1-fc protein and using it for metastases inhibition, polynucleotide coding protein, vector, host cell, method for producing fused protein, composition and method for metastases inhibition // 2531756
FIELD: medicine, pharmaceutics.SUBSTANCE: presented group of inventions refers to biotechnology, and concerns a DLK1-Fc fused protein and using it for the metastases inhibition, a polynucleotide coding such a protein, an expression vector containing the polynucleotide, a host cell producing the above fused protein, a method for producing the fused protein by culturing the above host cell, a composition containing the above fused protein, and a method for the metastases inhibition. The characterised fused protein contains a DLK1 extracellular soluble domain consisting of the amino acid sequence SEQ ID NO:4 and Fc domain of a human antibody.EFFECT: group of inventions can be used for preparing a therapeutic agent for reduction of cancer cell migration and the metastases inhibition.11 cl, 36 dwg, 3 ex

Transducible polypeptides for mitochondrial metabolism modification // 2529950
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to biochemistry. Application of a fused protein to obtain a composition for the body weight reduction is described. The fused protein contains a domain of transduction, a signal of mitochondrial localisation and a domain of a mitochondrial factor of transcription A, binding polynucleotide (TFAM), containing a group with high mobility. Methods of treating obesity by means of the said protein are described.EFFECT: invention extends an arsenal of means for treating obesity.9 cl, 5 dwg, 2 ex

ethod of production of casein calcium chloride // 2528978
FIELD: biotechnology.SUBSTANCE: invention relates to a method of production of casein calcium chloride of technical casein by precipitation, and can be used in microbiological studies for production of components of storing media of cultures of microorganisms, and also production of calcium co-precipitates for food industry.EFFECT: improvement of the method.2 cl, 1 tbl, 5 ex

Leukolectin and use thereof // 2528860
FIELD: medicine, pharmaceutics.SUBSTANCE: invention refers to biotechnology, namely to leukolectins, and can be used in medicine. What is prepared is the polypeptide leukolectin characterised by SEQ ID NO:1-8. The recombinant preparation is ensured by using a nucleic acid coding it and integrated into an expression vector which is used to transform a host cell. Testing absence-presence or determining an amount of the polypeptide leukolectin are ensured by using an antibody or an antigen-binding fragment of a variable region of the above antibody which is specifically bound to the polypeptide leukolectin. The polypeptide leukolectin or the nucleic acid coding it are used as ingredients of a pharmaceutical composition in therapy of pathological disorders of skin and mucous membranes.EFFECT: invention enables treating or preventing autoimmune disorders of skin, inflammatory diseases of skin or mucous membrane, or injured skin in an animal effectively.16 cl, 19 dwg, 3 tbl, 12 ex

Antibody to epha2 // 2525133
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to field of immunology, medicine and biotechnology. Claimed are versions of anti-EPHA2 antibodies. Claimed antibodies are bound with polypeptide, consisting of amino acids 426-534 in SEQ ID NO:8. Also described are hybridomes, which produce such antibodies, and pharmaceutical compositions and methods of application of said antibodies and compositions.EFFECT: invention can be used in medicine.74 cl, 14 dwg, 14 ex, 1 tbl

Antigen tau-peptides and their application // 2518291
FIELD: chemistry.SUBSTANCE: invention relates to field of biotechnology, in particular to immunogens based on antigenic tau-peptide, and can be used in medicine. Obtained is immunogen, which contains antigenic tau-peptide, consisting of amino acid sequence, selected from SEQ ID NO:6, 8-19, 21-26, 105 and 108-112, covalently bound with immunogenic carrier by means of linker, represented by formula (G)nC, where n equals 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. Linker can be located either on C-terminal (peptide -(G)nC), or on N-terminal (C(G)n-peptide) of peptide. Obtained immunogens are used as base for creation of pharmaceutical compositions for treatment of tau-associated neurological disorders.EFFECT: invention makes it possible to induce immune response against tau autoantigen in efficient way.12 cl, 10 dwg, 5 tbl, 16 ex

Application of peptide wnt5-a derivatives for treatment of gastric melanoma and cancer // 2517190
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to novel non-branched carbamate derivatives of some peptides Wnt-5a, in particular to N-butyloxycarbonyl derivative, their pharmaceutical compositions and their application for treatment of gastric melanoma and cancer.EFFECT: obtaining novel non-branched carbamate derivatives of some peptides Wnt-5a.7 cl, 9 dwg, 7 ex

uteins of tear lipocalin, possessing affinity to human c-met receptor tyrosine kinase and methods of obtaining them // 2515063
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to field of biotechnology, namely to muteins of human tear lipocalin, and can be used in medicine. Mutein of human tear lipocalin (hTLc) has identifiable affinity of binding with human receptor Met (c-Met) receptor tyrosine kinase, or its domain, or fragment of human c-Met. Mutein contains from 6 to 18 amino acid substitutions relative to amino acid sequence of mature lipocalin of human tear liquid (SWISSPROT DATABANK ENTRY P31025; SEQ ID NO:36), selected from group, consisting of Arg 26→Thr, Val, Pro, Ser, Gly; Glu 27→Gln, Gly, Val, Ser; Phe 28→Met, Asp; Pro 29→Leu, Ile, Ala, Trp; Glu 30→Leu, Gly, Arg, Phe; Met 31→Ser; Asn 32→Leu, Arg, Val, Gln; Leu 33→Tyr, Val, Ile, Thr, Phe; Glu 34→Val, Arg, Ala; Leu 56→Asn; Ile 57→Gln; Ser 58→Ile, Val; Asp 80→Tyr; Lys 83→Ala; Glu 104→Asp; Leu 105→Thr; His 106→Trp and Lys 108→Gly. Mutein can also additionally contain the following substitutions: Cys 61→Ser; Cys 101→Ser; Cys 153→Ser; Arg 111→Pro; Lys 114→Trp; Thr 37→Ser; Met 39→Ile, Leu; Asn 48→Ser; Lys 52→Thr, Met; Met 55→Leu; Lys 65→Arg, Leu; Ala 79→Leu, Ser; Ala 86→Thr; Ile 89→Ser, Gln, Thr, His; Thr 40→Cys; Glu 73→Cys; Arg 90→Cys; Asp 95→Cys; Lys 121→Cys; Asn 123→Cys and Glu 131→Cys.EFFECT: invention makes it possible to efficiently treat pathological disorders, which involve pathway HGF/c-Met, as well as to perform identification of human c-Met in sample.40 cl, 16 dwg, 9 tbl, 25 ex

Composition for treating prostate carcinoma (pc) // 2508125
FIELD: medicine, pharmaceutics.SUBSTANCE: invention refers to biotechnology. What is disclosed is a vaccine representing four RNAs coding a prostate-specific antigen (PSA), a prostate-specific membrane antigen (PSMA), a prostate stem cell antigen (PSCA) and a six-transmembrane epithelial antigen of the prostate (STEAP). The vaccine is applicable for treating prostate carcinoma, preferentially neo-adjuvant and/or hormone resistant prostate carcinoma, as well as related diseases or disorders. Using the vaccine and a kit are also disclosed. The invention can be used in medicine.EFFECT: preparing the vaccine for treating prostate carcinoma.16 cl, 23 dwg, 8 ex
 
2551164.
Up!