From mammals (C07K14/47)

Fusion serpine polypeptides and methods for their application // 2642310
FIELD: biotechnology.SUBSTANCE: invention relates to the field of fusion proteins for serine proteases inhibition, and can be used in medicine. Fusion proteins having at least one human alpha-1 antitrypsin (AAT) polypeptide operably linked to an immunoglobulin Fc polypeptide having an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO:6 are obtained.EFFECT: invention allows to obtain a fusion polypeptide capable of effectively inhibiting the activity of serine proteases and thereby alleviating the symptoms of diseases or disorders associated with overexpression or serine protease activity in a subject in need thereof.18 cl, 4 dwg, 4 ex

Immunotherapeutic compositions on the basis of yeast-muc1 and methods of their use // 2642300
FIELD: biotechnology.SUBSTANCE: fusion protein is produced which contains the MUC1 antigen having an amino acid sequence that is at least 85% identical to the sequence of SEQ ID NO: 25 or at least 95% identical to the positions 92-566 of the sequence of SEQ ID NO: 25, and where MUC1 antigen contains 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 of the following amino acids L184, Y232, L233, V240, V241, L242, Y483, V497, L335, F536 and Y551.EFFECT: invention allows to effectively treat Mucin-1-expressing carcinomas, and also to prevent their metastatic progression.14 cl, 3 dwg, 5 tbl, 10 ex

P53 peptidomimetic macrocycles // 2642299
FIELD: biotechnology.SUBSTANCE: stable cross-linked p53 peptidomimetic macrocycle, a method for its preparation and its use are proposed. The p53 peptidomimetic macrocycle has a structure represented in the formula, and interferes with binding of p53 to MDM2 and/or p53 to MDMX. The P53 peptidomimetic macrocycle can be used to prepare pharmaceutical compositions for treatment of cancer characterized by undesirably low or low p53 activity and/or for the treatment of cancer characterized by undesirably high levels of MDM2 or MDMX activity.EFFECT: proposed cross-linked p53 macrocycle has cell permeability that is at least twice as high as that of the corresponding macrocycle without cross-links.50 cl, 7 dwg, 9 tbl, 22 ex

Bis-met-histones // 2640247
FIELD: biotechnology.SUBSTANCE: nucleic acid molecule encodes a polypeptide consisting of two methionine residues as the first and second N-terminal amino acid residues linked through a peptide bond to the mature eukaryotic histone H1. 3. A polypeptide is prepared by culturing a host cell transformed with an expression vector comprising the said nucleic acid molecule. The polypeptide is used as part of a pharmaceutical composition for treatment of cancer, bacterial, viral or fungal infections. Also, the polypeptide is used as part of a composition for diagnosing a patient with respect to the presence of a response to a pharmaceutical composition containing the said polypeptide, or with respect to curability thereof.EFFECT: invention allows to increase the efficiency of recombinant expression and facilitate the determination of the said polypeptide in the presence of endogenous histones while maintaining biological activity of the mature eukaryotic histone.16 cl, 3 dwg, 6 tbl, 7 ex

Peptides suppressing respiratory viruse infections, their application and methods for obtaining // 2639559
FIELD: pharmacology.SUBSTANCE: inventions relate to a peptide synthesized chemically or genetically engineered, compositions comprising such a peptide, DNA coding a polypeptide, vector incorporating such a DNA, a host cell for expression of the peptide, a peptide screening Kit, capable of suppressing a respiratory virus infection and a method for screening of a peptide capable of suppressing a respiratory virus infection. The presented peptide contains 5 or more essential amino acids, 2 or more of these essential amino acids are located in the N-terminal or C-terminal region, and the N-terminal region contains a sequence of no more than 10 amino acids from the peptide N-terminal amino acid and the C-terminal region contains a sequence of no more than 10 amino acids from the peptide C-terminal amino acid, while the peptide consists of a sequence of amino acids, at least 90% identical to SEQ ID NO: 10.EFFECT: possibility of application of inventions to block infections of respiratory viruses such as influenza viruses or coronaviruses in the target cells for prevention and treatment of these infections.23 cl, 10 dwg, 3 tbl, 1 ex

Fusion polypeptide containing wap domain and their application methods // 2639526
FIELD: biotechnology.SUBSTANCE: fusion proteins having at least one polypeptide of the human secretory inhibitor of leukocyte proteases (SLPI) operably linked to an immunoglobulin Fc fragment polypeptide having an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO:10 are obtained.EFFECT: invention allows to obtain a fusion polypeptide capable of effectively inhibiting the activity of neutrophilic serine proteases and thereby alleviating the symptoms of diseases or disorders associated with overexpression or serine protease activity in a subject in need thereof.15 cl, 4 dwg, 4 ex

Analogues of complement factor b and their application // 2639521
FIELD: biotechnology.SUBSTANCE: invention can be used in medicine to treat a disease mediated by activation of an alternative complement pathway. A polypeptide consisting of hfB3-292S (amino acids 1-764 or 26-764 in SEQ ID NO: 2), hfB3-292SN480 (amino acids 1-480 or 26-480 in SEQ ID NO: 2) or hfB3-292S-Fc (amino acids 1-990 or 26-990 in SEQ ID NO: 22) is obtained.EFFECT: invention allows to effectively inhibit the activity of the alternative complement pathway when using the resulting polypeptide, coding its nucleic acid or expression vector.12 cl, 14 dwg, 6 tbl, 19 ex

Immunity inducing agent // 2639518
FIELD: medicine.SUBSTANCE: invention refers to the immunity inducing agent containing the effective number of at least one polypeptide with inducing immune system activity, which induces cytotoxic t-cells capable to destroy tumour cells expressing polypeptide CAPRIN-1. Also, method is represented to obtain the selected antigen-presenting cell in vitro, which presents polypeptide fragment CAPRIN-1 for class I molecule RENAMO t-cells, as well as in vitro method for obtaining selected cytotoxic t-cells specific to protein CAPRIN-1. The invention also relates to a method of induction of immunity, including the introduction of individual effective amount of at least one polypeptide with inducing immune system activity, which induces cytotoxic t-cells capable to destroy tumour cells expressing polypeptide CAPRIN-1.EFFECT: effectively destroys tumour cells expressing the CAPRIN-1 polypeptide.13 cl, 5 dwg, 6 ex

Liposomes containing oligopeptide fragments of myelin basic protein, pharmaceutical composition and method for multiple sclerosis treatment // 2639497
FIELD: biotechnology.SUBSTANCE: invention relates to the production of liposomes with a peptide of the myelin basic protein (MBP), and can be used in medicine for multiple sclerosis treatment. A composition is prepared containing the MBP peptide with SEQ ID NO: 11 or SEQ ID NO: 12 bound to the first vector, wherein the vector comprises a liposome having a surface exposed to the target portion that contains a mannose residue or a mannose derivative.EFFECT: invention provides greater therapeutic benefit than copaxone, therapeutically approved for the treatment of relapsing-remitting multiple sclerosis.18 cl, 14 dwg, 14 tbl, 14 ex

Improved n-terminal capping modules for constructed ankyrin repeat proteins // 2636552
FIELD: biotechnology.SUBSTANCE: invention relates to N-terminal capping modules for proteins. The resulting N-terminal capping modules for constructed ankyrin repeat (DARPin) proteins provide greater thermal stability of DARPin compared to the unmodified protein.EFFECT: increased compound stability.21 cl, 3 ex, 1 tbl, 4 dwg
ethod for production of active pharmaceutical substance of recombinant bismetionilystone h1.3 // 2634408
FIELD: biotechnology.SUBSTANCE: method involves cultivation of the E. coli strain B121 (DE3)/pEGT1/H1.3S producing the target protein, biomass disintegration, target protein extraction with perchloric acid, and subsequent purification of the target protein. This method is characterized by protein purification involving purification by cation exchange chromatography using washing of a sorbent coated with protein with a solution of 4 M urea and purification by HPLC. This method also comprises concentration of the purified bismethionylhistone by ultrafiltration and lyophilization to obtain a purified bismethionylhistone powder with a purity of 98.5%.EFFECT: preparation of bismethionylgystone of compendial grade.2 ex

odulation of structured proteins specificity // 2631931
FIELD: biotechnology.SUBSTANCE: ligands to human kallikrein, libraries of the said ligands and library sets of the said ligands are obtained by screening libraries of mutant peptides, characterized by the resulting ligand comprising the WPAR amino acid sequence.EFFECT: invention allows to obtain ligands for human kallikrein with increased specificity.15 cl, 16 dwg, 22 tbl, 6 ex

Fusion proteins for application as immunogenic amplifying agents to induce antigen-specific t-cell response // 2631002
FIELD: biotechnology.SUBSTANCE: invention relates to fusion proteins for application as an immunogenic enhancing agent to enhance antigen-specific T-cell responses, and can be used in medicine. A fusion protein is produced recombinantly, which comprises: (a) a binding domain with an antigen-presenting cell (APC) or a binding domain with the CD91 receptor; (b) a protein transduction domain; (c) a pathogenic antigen. The binding domain with the antigen-presenting cell (APC) or the binding domain with the CD91 receptor is located at the N-terminus of the fusion protein, and the pathogenic antigen is located at the C-terminus of the protein transduction domain.EFFECT: invention allows to obtain an enhanced antigen-specific T-cell response against a viral pathogen and cancer cell.16 cl, 15 dwg, 2 tbl, 6 ex

ethod for purification of recombinant protein containing myelopeptides sequences // 2630302
FIELD: biotechnology.SUBSTANCE: invention relates to a method for isolation of a recombinant protein comprising myelopeptides sequences and represented by the sequence of SEQ ID NO:1. The plasmid DNA of pET-32a/REC-MP carrying the gene represented by the sequence of SEQ ID NO:2 is used to transform competent bacterial cells of Escherichia coli BL21 (DE3) strain to obtain a soluble fraction of the thioredoxin/REC-MP fusion protein. Further, the fusion protein is purified on the metal-affinity sorbent using a Ni-Sepharose carrier. The fusion protein is then hydrolized with enterokinase-F enzyme, incubating for 1 hour at 37°C. Impurities are denaturated with heating to 74°C for 60 min. FPLC purification of the target recombinant protein on the SP-Sepharose ion exchange sorbent and reverse phase HPLC purification on a Kromasil 100C18 column are performed.EFFECT: invention allows to increase the expression of the target protein, improve the protein purification efficiency, resulting in homogeneity and almost 100% chromatographic purity of the product obtained.10 dwg, 3 tbl, 6 ex
Polybacterial drug with advantages for health: with antioxidant effect, decreased cholesterol concentration, anti-inflammatory and immuno-modulating effect, and release of bioactive peptides inhibiting angiotensin-converting enzyme // 2627651
FIELD: biotechnology.SUBSTANCE: group of inventions refers to polybacterial probiotic drug including new strains of lactic acid bacteria Lactobacillus gasseri 7/12 NBIMCC No. 8720, Lactobacillus plantarum F12 NBIMCC No. 8722 and Lactobacillus helveticus A1, NBIMCC No. 8721, which has anti-inflammatory immunomodulatory, hypocholesterolemic, antioxidant and antihypertensive activity. The group of inventions also refers to the use of drug as a probiotic agent, as well as an agent which has anti-inflammatory immunomodulatory, hypocholesterolemic, antioxidant and antihypertensive activity.EFFECT: food additives, food and functional products, pharmaceutical preparations that include this drug, have a beneficial effect on the health of people and animals.9 cl, 8 dwg, 15 tbl

Engineered repeat protein binding with serum albumine // 2625882
FIELD: biotechnology.SUBSTANCE: invention relates to production of new engineered proteins with binding specificity for serum albumin, which can be used in medicine. Proteins including the ankyrin repeat domain, as well as nucleic acids encoding such proteins and pharmaceutical compositions comprising such proteins for diseases treatment are produced recombinantly.EFFECT: invention allows a significant increase in blood plasma half-life compared to proteins that do not bind serum albumin.18 cl, 4 dwg, 3 tbl, 6 ex

Proteins binding to hepcidin // 2625011
FIELD: biotechnology.SUBSTANCE: lipocalin mutein is obtained which is at least 90% identical to the protein sequence selected from a group consisting of sequences SEQ ID NO: 1-14.EFFECT: invention allows for producing lipocalin mutein able to bind to hepcidin with an affinity based on the dissociation constant which is equal to approximately 10 nm or less.73 cl, 12 dwg, 11 ex

ethod for pancreatic cancer detection // 2624040
FIELD: medicine.SUBSTANCE: presented methods for pancreatic cancer detection include measurement of the presence or amount of a polypeptide having a reactivity in the form of specific binding with the CAPRIN-1 protein antibody via antigen-antibody interaction, or the presence or amount of a nucleic acid encoding this polypeptide, in a sample derived from an individual, wherein the polypeptide to be measured is CAPRIN-1 protein consisting of the amino acid sequence corresponding to any of even-numbered SEQ ID NO: 2-30, and wherein the presence or amount of nucleic acid encoding the polypeptide is determined by the nucleic acid encoding the polypeptide contained in the sample.EFFECT: invention allows simple detection of malignant tumours of pancreatic cancer.27 cl, 5 ex

odified peptides and their application for treatment of autoimmune diseases // 2620070
FIELD: medicine, pharmacy.SUBSTANCE: this invention relates to the field of biotechnology, particularly to an immunosuppressive agent, and can be used for the treatment of systemic lupus erythematosus (SLE). A peptide is obtained, consisting of the amino acid sequence IHMVYSKRSGKPRGYAFIEY [SEQ ID NO: 2] in which serine in position 9 is phosphorylated and methionine in position 3 is oxidized or of RIHMVYSKRSGKPRGYAFIEY [SEQ ID NO: 1], in which serine in position 10 is phosphorylated and methionine in position 4 is oxidized.EFFECT: invention provides peptide or salt thereof, effective in systemic lupus erythematosus treatment.8 cl, 6 dwg, 4 tbl, 4 ex

Recombinant plasmid pet-15b_t3_rl dna providing synthesis of recombinant fusion protein consisting of tumor-specific peptides and antitumor peptide rl2, and recombinant fusion protein possessing anti-tumor activity against human breast cancer // 2619053
FIELD: biotechnology.SUBSTANCE: pET-15b_T3_RL plasmid DNA is constructed which provides synthesis of recombinant fusion protein consisting of a tumor-specific peptide and an antitumor peptide RL2. The recombinant fusion protein isolated from Escherichia coli cells transformed with pET-15b_T3_RL plasmid, has a molecular weight of 15.9 kDa, consists of methionine residue, tumor specific peptide YTYDPWLIFPAN, glycine GGGS spacer, and a recombinant lactaptin RL2 analogue.EFFECT: production of a protein providing cytotoxic activity against cancer cells in culture and targeted properties for tumor tissue.2 cl, 6 dwg, 5 ex

Recombinant plasmid pet-15b_t1_rl dna providing synthesis of recombinant fusion protein consisting of tumor-specific peptides and antitumor peptide rl2, and recombinant fusion protein possessing cytotoxic activity against cancer cells and targeted properties against tumor tissue // 2619050
FIELD: biotechnology.SUBSTANCE: pET-15b_T1_RL plasmid DNA is constructed which provides synthesis of recombinant fusion protein consisting of a tumor-specific peptide and an antitumor peptide RL2. The recombinant fusion protein isolated from Escherichia coli cells transformed with pET-15b_T1_RL plasmid, has a molecular weight of 15.7 kDa, consists of methionine residue, tumor specific peptide GLHTSATNLYLH, glycine GGGS spacer, and a recombinant lactaptin RL2 analogue.EFFECT: production of a protein providing cytotoxic activity against cancer cells in culture and targeted properties for tumor tissue.2 cl, 6 dwg, 5 ex

Ledgf peptides and their compositions for treatment of degenerative diseases // 2617964
FIELD: biotechnology.SUBSTANCE: invention relates to production of full-length fragments of the eye lens epithelial growth factor (LEDGF), and can be used in medicine. LEDGF fragment with SEQ ID NO: 2 is obtained, which is used in pharmaceutical compositions for treatment of diseases associated with protein aggregation.EFFECT: invention can effectively treat diseases associated with protein aggregation, in particular ocular diseases.15 cl, 31 dwg
Recombinant protein mio-hsp, method of its production, injection preparation for muscle mass increase in farm animals, birds and animals of canids, as well as method of using preparation // 2613420
FIELD: biotechnology.SUBSTANCE: present invention relates to biotechnology and can be used for increasing muscle mass of farm animals, livestock and canines. Fused protein is obtained, consisting of myostatin, Gli-Ser spacer and glucan binding domain of alpha-glucan binding domain of Streptococcus mutans (Mio-HSP), that is used to produce injection preparation for subcutaneous or intramuscular injections in a dose of 50–200 mcg of said protein per one kg of animal body weight or poultry. For producing recombinant protein is grown cell strain E. coli M15 [rMio-HSP] - producer of recombinant protein myocardial HSP, which is obtained by transformation of cells of E. coli M15 plasmid rMio-HSP M15 containing a nucleotide sequence gene coding myocardial HSP, then bind protein myocardial HSP in paragraph 1 in the cell extracts strain E. coli M15 [rMio-HSP] with alpha-glucan binding sorbent by affine interaction incubation procedure, with further washing from unbound bacterial proteins and separating end product.EFFECT: invention allows to effectively induce synthesis of specific antibodies to myostatin, inhibit and, consequently, stimulate growth of muscular tissue.4 cl, 7 tbl, 6 ex

Block of ccl18 signaling through ccr6 as therapeutic method of treating fibrotic diseases and cancer // 2609649
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, namely to use of soluble polypeptide of CCR6 receptor in treating of interstitial pulmonary disease and/or lung cancer. Polypeptide containing CCLVYTSWQI, which consists of amino acid sequence, which has at least 90 % identity with respect to sequence according to SEQ ID NO: 9. Its fragment is also obtained, containing at least 12 amino acids of above sequence, including CCLVYTSWQI.EFFECT: invention allows preparing polypeptide capable to inhibit CCL18 induced step-down regulation of CCR6 expression.1 cl, 33 dwg, 17 ex

New allergen // 2608494
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, namely to novel horse allergens, and can be used in medicine for prophylactic or therapeutic treatment or diagnostics of type I allergy in horses. Horse allergen is obtained, which represents secretoglobin with molecular weight of 15 kDa in non-reducing conditions and contains first peptide chain with molecular weight of approximately 5 kDa and second peptide chain with molecular weight of approximately 10 kDa, linked to each other. Recombinant form of said allergen is also obtained.EFFECT: invention enables to obtain recombinant horse allergen with completely determined amino acid sequence.13 cl, 10 dwg, 3 tbl, 8 ex

Plasminogen and plasmin variants // 2604810
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology and can be used for production of plasminogen and plasmin variants. Version of plasminogen is obtained, containing activation site and catalytic domain, in which catalytic domain contains valine, substituted for isoleucine, in position 1 of catalytic domain of human plasmin or in position, corresponding to such in catalytic domain of plasmin, which differs from human plasmin where said catalytic domain of human plasmin starts with amino acid valine in position 1, which is the same amino acid valine in position 562 Glu-plasminogen of human with SEQ ID NO: 1.EFFECT: invention enables to obtain autoproteolytically stable variant of plasmin.19 cl, 14 dwg, 3 tbl, 2 ex

Plasminogen and plasmin variants // 2604807
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology and can be used for production of plasminogen and plasmin variants. Method comprises obtaining a variant of plasminogen, containing in its catalytic domain a replacement of glutamic acid with glutamine in position 138 of catalytic domain of human plasmin or in a position corresponding to such in a catalytic domain of plasmin other than human plasmin, where said catalytic domain of human plasmin starts with amino acid valine in position 1, which is same amino acid valine, occurring in position 562 of human Glu-plasminogen with SEQ ID NO: 1. wherein said variant of plasminogen can also contain a replacement of lysine with glutamic acid or histidine in position 147 and/or replacement of arginine with histidine in position 158 of catalytic domain of human plasmin.EFFECT: invention enables to obtain autoproteolytically stable variant of plasmin.33 cl, 14 dwg, 2 tbl, 2 ex

Recombinant plasmid dna pndctr1 coding hybrid polypeptide gst-ndctr1, escherichia coli bl21 (de3)/pndctr1 bacteria strain - producer of hybrid polypeptide gst-ndctr1 and hybrid polypeptide gst-ndctr1, making chelates of copper, silver and platinum ions // 2603092
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology and can be used for recombinant production of CTR1. Method comprises producing plasmid DNA pNdCTR1 coding hybrid polypeptide GST-NdCTR1, consisting of the N-terminal polypeptide fragment of glutathione-S-transferase (GST), connected via thrombin hydrolysis site with the polypeptide fragment of the N-terminal domain of a high-affinity human copper CTR1 (NdCTR1) importer. Size of the plasmid DNA is 5149 bps, the plasmid DNA comprises BamHI-XhoI - pGEX-4T-1 fragment with size of 4951 bps and SLC31A1 gene fragment with size of 198 bps, encoding the N-terminal domain of human CTR1 protein. Nucleotide NdCTR1 sequence and GST sequence are in the same reading frame. E.coli BL21(DE3) cells are transformed with the produced DNA pNdCTR1 to obtain an E.coli BL21 (DE3)/pNdCTR1 producer strain.EFFECT: invention allows producing hybrid polypeptide GST-NdCTR1 making chelates of copper, silver and platinum ions.3 cl, 4 dwg, 1 tbl, 5 ex

eans and methods for diagnosing and treating multiple sclerosis // 2601298
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, more specifically to use of peptide, consisting of at least 8 consecutive amino acid residues of the sequence set forth in SEQ ID NO: 3, for diagnosing multiple sclerosis, that can be used in medicine. Multiple sclerosis or a predisposition for multiple sclerosis in a subject are being diagnosed in case an anti-KIR4.1 antibody is present in the patient's sample.EFFECT: invention enables to obtain alternative means and methods for diagnosing and/or treating multiple sclerosis.9 cl, 8 dwg, 1 tbl, 6 ex

Tissue-regeneration promoter using recruitment of bone marrow mesenchymal stem cells and/or pluripotent stem cells in blood // 2599448
FIELD: medicine.SUBSTANCE: presented inventions relate to use of an agent stimulating tissue regeneration, and a method of stimulating repair of mesenchymal or epithelial neurological tissues by administering said agent. Described agent is an S100A8 protein, a cell which secretes an S100A8 protein, a vector into which DNA encoding S100A8 protein is inserted, an S100A9 protein, a cell which secretes an S100A9 protein or a vector into which DNA encoding an S100A8-9 protein is inserted.EFFECT: presented inventions can be used for inducing healing of injured tissues by recruiting bone-marrow-derived cells in area of damage, thereby treating such diseases as extensive pitting skin, bone fractures, cerebral infarction.7 cl, 44 dwg, 1 tbl, 9 ex

Biomarkers associated with pre-diabetes, diabetes and diabetes-related conditions // 2596486
FIELD: medicine.SUBSTANCE: invention relates to medicine and concerns a method, a test system for diagnosis of diabetic nephropathy. Disclosed method comprises determining in sample from a subject a biomarker, which is a similar CD5 antigen.EFFECT: using method enables to diagnose diabetic nephropathy.33 cl, 13 tbl, 4 dwg, 1 ex

Genetic nucleotide sequences of artificially modified gdnf with deleted pro-region, product of which has improved properties neural inductor and stimulator of formation of neural processes, suitable for therapy of neural injuries, ischemic strokes and neurodegenerative diseases, expression vector, modified with gdnf // 2595377
FIELD: biochemistry.SUBSTANCE: invention relates to biochemistry. Disclosed is cDNA of natural GDNF gene artificially modified by removal of pro-region, which in mammalian cells or tissues in standard vectors produces active specific GDNF. Invention also relates to an expression vector containing said cDNA, as well as to active specific GDNF encoded by said cDNA. During translation in cells and tissues said GDNF stimulates neural differentiation of stem and progenitor cells with formation of neural processes.EFFECT: invention increases activity of GDNF as neural inductor and stimulator of formation of neural processes and can be used in therapy of neurodegenerative disorders, traumatic disorders of innervation as well as ischemic cerebral apoplexies of mammals, including humans.3 cl, 13 dwg, 5 ex

ethod of inhibiting hiv replication in cells of mammals and humans // 2593948
FIELD: biochemistry. SUBSTANCE: invention relates to the field of biochemistry. Method of inhibiting replication of human immunodeficiency virus (HIV), involving treatment of mammalian cells with agent selected from group of peptides, interfering RNA or anti-sense oligonucleotide destructive structure proteins vimentin and/or keratin-10 of cytoskeletal intermediate filaments (IF) in mammal cell. Invention also relates to use of said agent for preparing drug for treating of HIV-infection. Besides, there are presented pharmaceutical compositions for treating of HIV-infection, containing said agent. EFFECT: invention increases HIV replication inhibition. 10 cl, 11 dwg, 2 tbl, 12 ex

Allergens produced by recombinant methods // 2592674
FIELD: biotechnology. SUBSTANCE: present invention relates to biotechnology, specifically to novel dog allergens, and can be used in medicine. Allergen Can f 4 is produced by recombinant method. Obtained allergen can be used during in vitro diagnosing or treating allergy, caused by dandruff or dogs wool. EFFECT: present invention enables to obtain allergen Can f 4 by recombinant method with completely determined amino acid sequence. 11 cl, 10 dwg, 5 tbl, 1 ex

Antibodies against isoforms of human protein oct-1, recombinant polypeptide and method of producing antibody // 2590715
FIELD: biotechnology.SUBSTANCE: invention relates to biotechnology, genetic and protein engineering. Invention discloses a recombinant polypeptide, having specific immunogenic properties of isoforms Oct-1, comprising an N-end section of human Oct-1A, a linker and 6 histidine residues; as well as a method for preparing polyclonal antibodies against isoforms of Oct-1 using said polypeptide. Polypeptide has sequence MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHGAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQAFHHHHHH.EFFECT: present invention enables to produce antibodies binding isoforms of human Oct-1A, Oct-1L and Oct-1B and can also be used to produce antibodies with high affinity and specificity with other isoforms of Oct-1.2 cl, 6 dwg

Neuregulin antagonists and use thereof in treating malignant growth // 2587619
FIELD: biotechnology.SUBSTANCE: invention relates to method of increasing period of time to recurrence, and can be used in medicine. Neuregulin antagonists are obtained, which are anti-NRG1 antibody siRNK or shRNK targeted NRG1, or immune-adhesine to NRG1 for administering the previously recieved anticancer therapy, in combination with therapeutic agent specified in paclitaxel, cisplatin or their combination for delay time to recurrence or prevent development of cancer cell resistance to therapeutic agent.EFFECT: invention allows to increase period of time to recurrence, which increases survival rate of patients.10 cl, 8 dwg, 1 tbl, 8 ex
Peptidomimetic macrocycles // 2582678
FIELD: medicine, pharmaceutics.SUBSTANCE: invention refers to new peptidomimetic macrocycles and methods for using these macrocycles to modulate p53 and/or HDM2, HDMX activity.EFFECT: producing new compounds.33 cl, 8 dwg, 4 tbl, 13 ex

Apoptosis inhibitors and use thereof // 2582247
FIELD: biotechnologies.SUBSTANCE: invention relates to production of DAXX protein antiapoptotic fragments and can be used in medicine for treating acute myocardial infarction (AMI), cerebral infarction, during organ transplantation, operations on heart, acute blood circulation disorders, reperfusion injuries and ischaemia. Obtaining biologically active fragments form 17-24 sequential amino acids of DAXX protein including KKSRKEKKQTGSGPLG, as well as their peptide mimetics and conjugates with peptide penetrating into cells.EFFECT: invention allows effective inhibition of cell apoptosis, in particular cell apoptosis mediated by Fas receptor.22 cl, 17 dwg, 4 tbl, 1 ex

ethod for producing lactoferrin, lactoferrin-containing fraction and using it // 2579661
FIELD: medicine, pharmaceutics.SUBSTANCE: group of inventions refers to biotechnology. A raw material is presented by milk, which has not been processed at a temperature of more than 55°C. The above raw material is extracted on cation-exchange resin with using a concentrated solution of sodium chloride. A solution of primary milk protein containing lactoferrin, lactoperoxidase and other foreign matters is produced. The solution of primary milk protein is purified on cation exchange resin balanced with acetate buffer in the concentration of 50 mM at pH from 4 to 9. An elution procedure is ensured with using acetate buffer solutions in the concentration of 50 mM with the different concentrations of the sodium chloride solution - from 0.02 to 1.5 M. A lactoferrin-containing fraction is collected. The fraction contains more than 95% pure lactoferrin and is substantially free from lipopolysaccharides, endotoxins and angiogenin and has an iron saturation level from 9% to 20%. The produced fraction is applicable to accelerate maturation of a newborn's gastrointestinal tract or to recover a post-gastroenteritis intestinal mucosa, to increase monocyte activity and to improve the cytotoxic function of killer cells, as an anti-inflammatory agent, to reduce expression of anti-inflammatory cytokines, to inhibit or eliminate bacteria, to treat the diseases associated with bacterial films, to prepare solutions or ointments for wound cleaning or eye care, and to treat infectious respiratory diseases.EFFECT: method for producing lactoferrin, the lactoferrin-containing fraction and using it are presented.15 cl, 4 tbl, 11 dwg

ethod of use in therapy // 2579659
FIELD: bioengineering.SUBSTANCE: invention relates to use of the antigenic compound including the antigenic peptide produced from amyloid protein or amyloid-like protein for medical treatment of the disease, state or distress due to or linked with the said protein in population of patients suffering from insufficiency of T-cells during induction of the immune response. The said antigen peptide is modified by lipophilic or hydrophobic part of the molecule, that makes easier insertion to the lipidic double layer of the liposomal carrier/adjuvant, and is presented in form of frequently repeated matrix on surface of the liposome. The said antigen compound is used for medical treatment of the disease, state or distress due to or as result of amyloid protein or amyloid-like protein in amount sufficient for induction of the immune response independent from T-cells.EFFECT: invention permits use of the said antigen compound as per new medical application, namely, for medical treatment of the diseases, when it is desirable to generate immune bodies independent from T-helper cells, for example, at animals or people with the immunodeficiency or with autoimmune diseases, such as Alzheimer's disease.51 cl, 22 dwg, 6 tbl, 6 ex

Glycosylated congugates of molecules with repeating motif // 2574201
FIELD: chemistry.SUBSTANCE: invention relates to field of biochemistry, in particular to methods for obtaining glycosylated conjugate of molecule with repeating motif for binding with antibody, which includes the following stages: 1) obtaining cells; 2) cultivation of cells; 3) separation of glycosylated conjugate of molecule with repeating motif from cells; 4) optional purification of separated glycosylated conjugate of molecule with repeating motif.EFFECT: invention makes it possible to reduce content of by-products in the process of obtaining glycosylated conjugate of molecule with repeating motif.5 cl, 19 dwg, 7 ex

ethod of purifying growth factor protein // 2571926
FIELD: chemistry.SUBSTANCE: invention relates to biotechnology and particularly to a method of purifying G-CSF (granulocyte-colony stimulating factor) in a purification sequence using chromatography. The method includes performing chromatography at least once using a multimodal resin with a negatively charged ligand in the form of 2-(benzoylamino)butanoic acid. G-CSF is bound with the multimodal resin at pH in the range of 4-6.2. The G-CSF is eluted at pH higher than 6.3 or with an elution agent in an elution buffer, where said elution agent includes an amino acid having a backbone chain and/or high ionic force in the elution buffer selected from a group consisting of arginine, lysine and/or histidine. Concentration of the elution agent is in the range of about 0.1 M to about 2.0 M.EFFECT: present invention enables to obtain purified G-CSF with high output.14 cl, 14 dwg, 10 tbl, 11 ex

ethod for high-efficiency collection of functional cells in vivo // 2571230
FIELD: chemistry.SUBSTANCE: present group of inventions relates to biotechnology and methods of collecting functional cells (versions). The described solutions comprise implantation of an implantable medical vessel under the skin for not more than two weeks, where a cell population is immobilised in the vessel using any of the proteins HMGB1, HMGB2, HMGB3, S100A8, S100A9 or hyaluronic acid or mixtures of any two or more thereof. Said factors have an activity of attracting specific functional cells into the body.EFFECT: present inventions provide efficient and safe collection of biologically functional cells, particularly stem cells.7 cl, 37 dwg, 1 tbl, 12 ex

Novel molecule inhibitors of jnk // 2570417
FIELD: medicine.SUBSTANCE: invention relates to novel molecule inhibitors of JNK, methods of obtaining antibodies to said molecule inhibitors of JNK, as well as to respective antibodies and cells, producing said antibodies.EFFECT: obtaining novel molecule inhibitors of JNK.20 cl, 32 dwg, 4 tbl, 9 ex

Novel tumour biomarker // 2567005
FIELD: medicine.SUBSTANCE: invention relates to biochemistry. Method includes determination of level of polypeptide with said sequence in plasma by means of antigen, where Thr90 of polypeptide is phosphorylated. Also diagnostic sets for detection of presence of tumour metastases are described, for screening for presence of tumour among high risk population, for determination of prognosis for patient, for determination of efficiency of surgery, radiotherapy or chemical therapy with respect to patient with tumour, and/or determination of the time when treatment must be stopped. Diagnostic sets include polypeptide with sequence, given in materials, where Thr90 of polypeptide is phosphorylated.EFFECT: described are methods for detection of presence or metastases of tumour, screening for presence of tumour among high risk population, prognosis for patient with tumour, determination of efficiency of surgery, radiotherapy or chemical therapy.27 cl, 20 dwg, 18 ex

Versions of plasminogen and plasmin // 2564131
FIELD: medicine, pharmaceutics.SUBSTANCE: invention relates to field of biotechnology, namely to obtaining versions of plasminogen and plasmin, containing one or several point mutations in catalytic domain, which reduce or prevent autocatalytic loss of plasmin protease activity, and can be used in medicine.EFFECT: invention makes it possible to obtain autoproteolytically stable plasmin.51 cl, 10 dwg, 3 tbl, 5 ex

Synthetic peptide for preparing monospecific antibodies against isoform 2 of eukaryotic translation elongation factor 1a // 2562880
FIELD: medicine.SUBSTANCE: what is presented is a peptide derivative for producing specific antibodies reacting to isoform 2 of translation elongation factor 1A (eEF1A2), but not reacting to isoform 1 of translation elongation factor 1A (eEF1A1), containing a fragment of the amino acid sequence of eEF1A2 in the position from 330 to 343. There are also presented method for producing the monospecific antibodies reacting to eEF1A2, but not to eEF1A1 on the basis of using the peptide derivative according to the invention, and using it for the affine purification of these monospecific antibodies.EFFECT: invention can be used for developing immune test systems for identifying cells with changed biological apoptosis control apparatus in biological samples capable of malignant transformation and tumourogenesis.3 cl, 9 dwg, 10 ex

Antibodies, containing therapeutic tpo/epo mimetic peptides // 2559526
FIELD: medicine.SUBSTANCE: claimed invention relates to field of biotechnology. Claimed are: therapeutic antibody and therapeutic antibody fragment for increasing production of platelets, including thrombopoetin (TPO) mimetic peptide, which contains sequence IEGPTLRQWLAARA, and inserted as addition to C-terminus of constant region of light chain and/or in position of less than 20 amino acids following C-terminus of hinge region of heavy chain. In addition, described are composition, containing antibody or its therapeutically active fragment, and method of increasing production of platelets in individual, including introduction of said composition, as well as nucleic acid, coding antibody polypeptide, containing TPO mimetic polypeptide.EFFECT: invention enables higher and faster production of platelets in comparison with knows structures of antibody, where mimetic peptide is inserted instead of one of CDR.13 cl, 4 dwg, 9 ex

External cow lipopolysaccharide epitope h. pylori // 2558257
FIELD: chemistry.SUBSTANCE: present invention relates to biotechnology and provides a α1,6-glucan-containing compound of Helicobacter pylori. The present invention also discloses a conjugate for inducing immune response against H.pylori, which contains said compound conjugated with a carrier protein. The present invention also discloses an immunogenic composition, use of said composition and a method of inducing immune response against H.pylori using said composition. The present invention also discloses immune serum for neutralising H.pylori in mammals, which is obtained by immunising said mammal with an immunogenic composition containing said immunogenic composition. The present invention discloses an antibody which recognises said α1,6-glucan-containing compound of H.pylori, use of said antibody and a method of inducing complement-mediated bacteriolysis of H.pylori strains which express α1,6-glucan using said antibody.EFFECT: invention improves the effectiveness of immunogenic compositions against Hpylori.27 cl, 8 dwg, 21 tbl, 11 ex

Cell-penetrating peptides and thereof application // 2556800
FIELD: chemistry.SUBSTANCE: invention relates to field of biotechnology, namely to internalisation of therapeutic molecules into cell, and can be applied in medicine. Obtained is composition for delivering molecules of nucleic acids into cells, containing at least one peptide with at least 92% identity to GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); or YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), bound to one or several molecules of nucleic acids.EFFECT: invention makes it possible to increase efficiency of delivery of molecules of nucleic acids into mammalian cell due to peptide, capable of internalisation into mammalian cell with efficiency, constituting at least 200% of efficiency of internalisation of peptide TAT, which has amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1).8 cl, 16 dwg, 1 tbl, 8 ex
 
2550983.
Up!